CAZyme Information: PYU1_T003512-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T003512-p1
• CAZy Family: GH17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
808		88790.64	7.8261

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2006:11579-14005(-)

Full Sequence      

MKIAASTLFIYLGLLQHHQQSLHAAAQDAGLDRSPSPSLEMPDNAASSASSFTGSIPSIP
LPAPPVSTDPPALNSPAPIDSGSGSSHNNNNNATYGSPQPLEPPASLLEHTDAASRLCPP
KYLDPSVINNRAIPTNNWWGNIIAHDSGSKIQPVWSNPYALQVVADLAPFGLAVSYPYRS
RVSGGTSGNSGANRYYAHGILREFMFSSSEFASTKPEFRVLDWADQGVTVQLKSGAGKLE
SDLVSGMVYTTAKYTSLSPKLTSTAAISSVNGKAARSGDVFRGSKFEVSYNSGQTWVVYA
LSSDGTSDKEISLTVDGGSSLKASGSFNGILRTALAVENSWVPTLDTYRSCIVQGASVSP
ESDAAYSFNWKTMGNCASGLLHYAMAHHMDSMDASGSGPQKVAGMVTHSTTRGSFQAYAT
RPSSTLVWKFSETQQVPSDFYPARKVPPSVIQSQRILEHLRTDIVNTDWSIPKGGSYYFN
GKAAQKYASLCLMANDAAIVGQDKSLLSQCLAKLRTVMLPFVNNGWANKLQYDRVYRGIV
SSEGYKKNDLNADFGNTMYNDHHFHYGYWIHTAAMINLLDPSWSELNKLNTMANLLVRDV
ANFDDRDKYFPRFRSFDWFRGHSYSHGVTPLADGKDQESSSEDVNFSFGMYMFGKVTNQR
DMMNVGKLMTRVNAHAIKTYFLMEDQNQVHPPNFRPNKVTGIFFDNKVDYATWFSAEKYC
IHGIQMIPVSAVTEFVRTKQFVQQEWDQVLSREKIVTSQDTGNAWLSLLYLNYAAVNKNK
AMGVLQKAKMDDGLTRSWALYMAASFSD

Enzyme Prediction     

No EC number prediction in PYU1_T003512-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	129	801	9.5e-182	0.9726688102893891

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	4.83e-150	475	800	29	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	1.03e-142	119	807	79	756	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	2.33e-47	129	439	11	313	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ20868.1|GH81	0.0	1	808	1	794
UIZ20873.1|GH81	0.0	1	808	1	794
UIZ20872.1|GH81	0.0	1	808	1	794
UIZ20875.1|GH81	0.0	1	808	1	794
CCA25006.1|GH81	8.45e-282	103	807	34	737

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	4.06e-113	129	805	37	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	7.48e-113	129	805	62	742	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	6.89e-109	129	805	37	717	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	1.82e-29	560	774	414	623	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	9.53e-23	472	794	355	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	4.33e-97	133	804	35	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	2.29e-91	133	804	226	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	9.34e-86	133	807	111	779	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|P53753|ENG1_YEAST	2.56e-81	120	808	421	1114	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	2.27e-78	133	804	82	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.004403	0.995556	CS pos: 24-25. Pr: 0.9367

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T003512-p1.