CAZyme Information: PYU1_T002415-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T002415-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		43433.16	9.9973

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2008:703410-704627(-)

Full Sequence      

MKFARLALTTIAAVLVHSASAVTIGSAPGLAAGTTGGGSAAPVYPKTIWELRSYLSDSQP
RVIYLNRAFDYRGSEGSKTETGCRPKSNRECIAKKNGHKGQDVILQSGGMANTGGCIEGT
PVSITYDIAATKNPLQVTDNKTLRGIGNAGVIIGKGLWINGNNVIIQNVHITNLNPHLIW
GGDAIYIQGKNGGSTPMERVWIDHVKISLVGRQMMTTNTASVKSMTISNSDFDGRTSWSA
SCDGRHYWTFIFHGTQTRISMIKNYVHSTSGRSPKFGGSTDPKTDVVAHAVNNYWADNSG
FSFDVAEKAFVLMEGNYFESTANPNLQDSTTTGSVFVPTSSNQNYCKLYLGRKCVGNVLQ
NSGKLVSRQDSVAIARLKGLTGKYTPTDAKKLTIVTSNFGVGALK

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	124	319	4.8e-79	0.983957219251337

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	2.44e-28	121	321	1	189	Amb_all domain.
226384	PelB	7.01e-11	97	404	51	344	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	1.77e-09	132	318	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19255.1|PL1_4	1.06e-189	1	404	1	398
ACR19252.1|PL1_4	1.17e-189	18	404	52	432
ACR19247.1|PL1_4|4.2.2.10	1.75e-188	1	404	1	398
ACR19251.1|PL1_4	2.48e-188	1	404	1	398
ACR19249.1|PL1_4	1.07e-180	18	404	52	432

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	5.67e-74	25	404	5	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	6.28e-73	24	381	4	337	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.38e-69	25	404	5	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q0CZD4|PELF2_ASPTN	3.57e-97	12	404	11	380	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|B8N316|PELF_ASPFN	8.67e-94	8	404	7	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1
sp|Q2UJA7|PELF_ASPOR	8.67e-94	8	404	7	382	Probable pectin lyase F OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pelF PE=3 SV=2
sp|A2R6A1|PELF_ASPNC	1.40e-92	16	404	18	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q8NJK6|PELF_ASPNG	1.40e-92	16	404	18	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000240	0.999723	CS pos: 21-22. Pr: 0.9797

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T002415-p1.