CAZyme Information: PYU1_T002413-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T002413-p1
• CAZy Family: GH1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
405		42909.29	9.5579

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2008:712294-713511(-)

Full Sequence      

MKIFRFALVFVAAALAQTTSAITIGSAPGLAAGTTGGGSATPVYPTTIAQLKSYLSDSTT
RVIYLNRSFDFRGTEGTKTEAGCRPLSNRQCIAKNNGYKGQDVILQSGGMANTGGCVEGT
SVTVTYDIAATKNPLQVGPNKTIRGIGTSGVIIGKGLWLNGDNIILQNVHITNLNPHLIW
GGDAIYMQGTNGGTTPQQKIWIDHVKISNIGRQMMAVNSAGAKTMTISNSEFDGQTQYSA
TCDGRHYWTFLFFGTESRISMIKNYVHHTSGRSPKFGGSGDSKTDVVAHAVNNYWADNSG
FSFDAAEKSYVLMEGNYFQSTVNPNLDDSTTTGAVFVPTSSNQNYCKLYLGRNCQLNVLS
SSGALKGRSDSTAIAKLKGLTAGYTPVAAAKLTKATANFGVGNLS

Enzyme Prediction     

EC	4.2.2.10:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL1	123	319	8.2e-80	0.9893048128342246

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214765	Amb_all	3.58e-26	122	321	2	189	Amb_all domain.
226384	PelB	3.33e-13	73	347	18	304	Pectate lyase [Carbohydrate transport and metabolism].
366158	Pec_lyase_C	5.44e-08	132	318	27	211	Pectate lyase. This enzyme forms a right handed beta helix structure. Pectate lyase is an enzyme involved in the maceration and soft rotting of plant tissue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACR19255.1|PL1_4	1.30e-190	1	405	1	399
ACR19247.1|PL1_4|4.2.2.10	2.14e-189	1	405	1	399
ACR19251.1|PL1_4	2.14e-189	1	405	1	399
ACR19252.1|PL1_4	4.89e-184	17	402	51	430
AHX74068.1|PL1_4	6.97e-181	1	405	1	400

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1IDK_A	1.32e-78	25	404	5	359	Pectin Lyase A [Aspergillus niger]
1QCX_A	2.92e-77	24	400	4	358	Pectin Lyase B [Aspergillus niger]
1IDJ_A	2.02e-74	25	404	5	359	Pectin Lyase A [Aspergillus niger],1IDJ_B Pectin Lyase A [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8NJK6|PELF_ASPNG	1.26e-96	17	404	19	383	Probable pectin lyase F OS=Aspergillus niger OX=5061 GN=pelF PE=3 SV=1
sp|A2R6A1|PELF_ASPNC	1.26e-96	17	404	19	383	Probable pectin lyase F OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=pelF PE=3 SV=1
sp|Q0CZD4|PELF2_ASPTN	1.40e-93	24	370	24	346	Probable pectin lyase F-2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=pelF-2 PE=3 SV=1
sp|Q5BA61|PELB_EMENI	1.12e-90	13	404	12	379	Pectin lyase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pelB PE=2 SV=1
sp|B8N316|PELF_ASPFN	3.41e-87	24	404	24	382	Probable pectin lyase F OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pelF PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000193	0.999791	CS pos: 21-22. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T002413-p1.