CAZyme Information: PYU1_T002299-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T002299-p1
• CAZy Family: CE9
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	PultDAOMBR144_SC2008|CGC3	90177.50	5.4139

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2008:1067938-1070736(+)

Full Sequence      

MKLGGFQYCWLLAALAAVGASADQTATTTDWSTSAKAIDAESYESGTVHALNGAKQSVPY
SSAPSSIGFESDAMTSAVQQSVPMATPSKTKPGTMATKTPMLAPIINIAQDVFTAERPIP
TNKWWGNLIHTTEKDRDTVANPAWSNPYAVKLPKKDAPFGLQACYSYTYRQKAALKDDKI
KFYLHEYHNDLTLSAQEFTAKPNYEIYDWSDLGASLRICTGTGGAQSTQCMKSSLVNGMA
FISSTYEGLTPKIASEYAITKLEQGAEGKYVIQLENKQTWVLYTSTATTLKIDGTGKAIV
ASAAYTGSIRVAVVPANASVDVYDSFASCTVLGGTVSVESRTQYSLNWDVEGSSCDSTGL
LHFAFQHQIDSMSNAAQSVNTTDAIQLESTVRGTMVGQIKRKSASSNSIKWTLTEPELTD
DIDFYPPRKPVATAVAQIKQALEADIASDWILAKDGSYYFNGKAYQKYASLCLMADDESI
MGSDKTLKATCLTKLKALIEPFLANGWAAPLAYETTYRGIISSLVFQTNDVNVEFGNGVY
NDHHYHYGYWIAASAMLKKLDPTWSRMAELEEIVWSLLRDVANPSSEDKYFPTFRHFSWF
LGHSYSHGVTPLADGKDQESTSEDVNFLYGMMLWGKVTGNKAVEDLGSLMLRIDARAIRT
YFLMDSNNKVHPPEFVRNHVTGIFFDNKVDYATWFSPEKYCIHGIQMIPVSPINEIVRTR
QFIKEEWDDILSNEAIVKDASSTSAWLSLLYVNYATIDQQAAMQRLATVQMDDGLTRSWA
LYNAATRPTGSSTSTTPTPEASVVTPTATATPSTAPYAPAY

Enzyme Prediction     

No EC number prediction in PYU1_T002299-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH81	114	782	8.9e-177	0.9742765273311897

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407548	Glyco_hydro81C	1.29e-146	432	781	4	349	Glycosyl hydrolase family 81 C-terminal domain. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release. This entry represents the helical C-terminal domain.
227785	Acf2	2.98e-132	118	785	89	753	Endoglucanase Acf2 [Carbohydrate transport and metabolism].
397619	Glyco_hydro_81	1.73e-50	118	426	14	318	Glycosyl hydrolase family 81. Family of eukaryotic beta-1,3-glucanases. Within the Aspergillus fumigatus protein ENGL1, two perfectly conserved Glu residues (E550 or E554) have been proposed as putative nucleophiles of the active site of the Engl1 endoglucanase, while the proton donor would be D475. The endo-beta-1,3-glucanase activity is essential for efficient spore release.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
UIZ26438.1|GH81	0.0	102	794	66	747
UIZ26440.1|GH81	0.0	102	794	66	747
UIZ26131.1|GH81	2.40e-263	102	795	35	722
UIZ26137.1|GH81	4.57e-263	102	795	145	832
UIZ26602.1|GH81	4.57e-263	102	795	145	832

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4K3A_A	2.08e-105	119	788	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K3A_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
5XBZ_A	3.73e-105	119	788	66	744	Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XBZ_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminaripentaose [Rhizomucor miehei],5XC2_A Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_B Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_C Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei],5XC2_D Crystal structure of GH family 81 beta-1,3-glucanase from Rhizomucr miehei complexed with laminarihexaose [Rhizomucor miehei]
4K35_A	2.37e-101	119	788	41	719	The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei],4K35_B The structure of a glycoside hydrolase family 81 endo-[beta]-1,3-glucanase [Rhizomucor miehei]
6FOP_A	6.13e-30	119	762	35	630	Chain A, Glycoside hydrolase family 81 [Acetivibrio thermocellus ATCC 27405]
5V1W_A	1.58e-21	322	775	243	667	Chain A, Glycoside Hydrolase [Halalkalibacterium halodurans C-125]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09850|ENG2_SCHPO	5.96e-96	103	785	23	700	Ascus wall endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng2 PE=1 SV=1
sp|D4AZ24|ENG1_ARTBC	1.63e-93	118	785	225	900	Probable endo-1,3(4)-beta-glucanase ARB_01444 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_01444 PE=1 SV=1
sp|Q12168|ENG2_YEAST	8.21e-82	118	781	110	772	Endo-1,3(4)-beta-glucanase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ACF2 PE=1 SV=1
sp|Q9UT45|ENG1_SCHPO	5.13e-81	118	785	81	735	Primary septum endo-1,3(4)-beta-glucanase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eng1 PE=3 SV=1
sp|P53753|ENG1_YEAST	2.12e-77	111	781	426	1106	Endo-1,3(4)-beta-glucanase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DSE4 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000203	0.999777	CS pos: 22-23. Pr: 0.9781

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T002299-p1.