CAZyme Information: PYU1_T001516-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T001516-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
304		31689.46	4.2319

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2029:498072-498986(-)

Full Sequence      

MLAPSSKTVLACAVAALVAAPAAVNAHGYMSVPKVTFSISGDTTQFCGTIDGPSTLTAPT
GMSFTTDPASNTAAFTKALANSSYTSVRELVEDKGVFITGATKTCGITEETEDPQPLPAK
YVEWSHSSTEGFTASHQGPCEVWCDDNLAFSDENCAADYTTAPAQLPYDRTKCLGTSLLK
IVWLALHSSTWQIYINCATLETTTASSSTSSAVASSTGSESASEATTEPTSASASTTTDD
EYSTSSTTTDEYSSASTTSDEYSSASTTTDEYSSASTSEEISTPAPTPSTTKKCTAKTSR
KRRN

Enzyme Prediction     

No EC number prediction in PYU1_T001516-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	14	266	2.1e-67	0.9346938775510204

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411773	SP4_N	0.003	225	291	277	341	N-terminal domain of transcription factor Specificity Protein (SP) 4. Specificity Proteins (SPs) are transcription factors that are involved in many cellular processes, including cell differentiation, cell growth, apoptosis, immune responses, response to DNA damage, and chromatin remodeling. Human SP4 is a risk gene of multiple psychiatric disorders including schizophrenia, bipolar disorder, and major depression. SP4 belongs to a family of proteins, called the SP/Kruppel or Krueppel-like Factor (KLF) family, characterized by a C-terminal DNA-binding domain of 81 amino acids consisting of three Kruppel-like C2H2 zinc fingers. These factors bind to a loose consensus motif, namely NNRCRCCYY (where N is any nucleotide; R is A/G, and Y is C/T), such as the recurring motifs in GC and GT boxes (5'-GGGGCGGGG-3' and 5-GGTGTGGGG-3') that are present in promoters and more distal regulatory elements of mammalian genes. SP factors preferentially bind GC boxes, while KLFs bind CACCC boxes. Another characteristic hallmark of SP factors is the presence of the Buttonhead (BTD) box CXCPXC, just N-terminal to the zinc fingers. The function of the BTD box is unknown, but it is thought to play an important physiological role. Another feature of most SP factors is the presence of a conserved amino acid stretch, the so-called SP box, located close to the N-terminus. SP factors may be separated into three groups based on their domain architecture and the similarity of their N-terminal transactivation domains: SP1-4, SP5, and SP6-9. The transactivation domains between the three groups are not homologous to one another. SP1-4 have similar N-terminal transactivation domains characterized by glutamine-rich regions, which, in most cases, have adjacent serine/threonine-rich regions. This model represents the N-terminal domain of SP4.
223039	PHA03307	0.005	218	303	283	368	transcriptional regulator ICP4; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ08725.1|AA17	2.04e-71	13	214	10	209
EGZ08724.1|AA17	5.50e-71	13	215	10	211
ETI41722.1|AA17	7.13e-70	13	210	10	206
ETO70366.1|AA17	9.05e-70	13	210	10	206
ETP39587.1|AA17	2.56e-69	13	210	10	206

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	2.99e-10	73	200	42	170	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PYU1_T001516-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999743	CS pos: 26-27. Pr: 0.9775

TMHMM  Annotations     

There is no transmembrane helices in PYU1_T001516-p1.