CAZyme Information: PYU1_T001514-p1

Basic Information

• Species: Globisporangium ultimum
• Lineage: Oomycota; NA; ; Pythiaceae; Globisporangium; Globisporangium ultimum
• CAZyme ID: PYU1_T001514-p1
• CAZy Family: AA17
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		47710.45	3.8603

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_GultimumDAOMBR144	15430	431595	140	15290

• Gene Location: location=PultDAOMBR144_SC2029:503125-504924(+)

Full Sequence      

MMTPSKMTGVLAVLAAVAPLGVSAHGYMSVPKVTFATSGDPTQFCATLDGPSTLTAPSGM
SFTTDPESNTKAFAAAFKAQSTYKSMRALVDAKGVFQPGMDKQCGVTSATGAKQPLPAKY
VEWAHSSSEGFTPSHQGPCEVWCDNTRVFQDDNCAKDYTTAPALLPYDRSKCVGASMLKI
YWLALHSSTWQAYINCAPLEGGSSSGASASTGSDAATPSVTPATASASSDNEYDDEYATP
APATTAPSSSSAEEDCDDELDLAGSEASGSVGAEEDCDDELDLAGSDEVGADADAEVGAD
ADPTAASGSEDCDDELDIAGSDASGSEDCDDDLSLAGSDEAAGSDSAVTTAPETTSSPAT
ITKAPSTTTKTPKPTKTKKTKTPKPTKTKKTKTPKPTKTKNEASGSVGAEEDCDDELDIA
GSEASGSEDCDDELDIAGSEAAAAATTSSLNFDSLSSNDASEVGTVDAY

Enzyme Prediction     

No EC number prediction in PYU1_T001514-p1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA17	13	254	6.2e-75	0.9183673469387755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
411231	MSCRAMM_ClfA	5.51e-04	214	468	589	846	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	0.001	198	468	565	834	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	0.003	253	460	583	792	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411231	MSCRAMM_ClfA	0.004	214	463	625	873	MSCRAMM family adhesin clumping factor ClfA. Clumping factor A is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). It is heavily studied in Staphylococcus aureus both for its biological role in adhesion and for its potential for vaccination. Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.
411414	MSCRAMM_ClfB	0.004	214	440	581	806	MSCRAMM family adhesin clumping factor ClfB. Clumping factor B is an MSCRAMM (Microbial Surface Components Recognizing Adhesive Matrix Molecules). Features of the sequence, but also of other MSCRAMM adhesins, include a long run of Ser-Asp dipeptide repeats and a C-terminal cell wall anchoring LPXTG motif.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EGZ08725.1|AA17	5.21e-63	5	208	6	204
ETI41723.1|AA17	8.06e-61	22	208	21	204
ETN20047.1|AA17	8.06e-61	22	208	21	204
ETP11446.1|AA17	8.55e-61	22	208	21	204
ETO70367.1|AA17	8.55e-61	22	208	21	204

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6Z5Y_A	9.70e-17	80	203	50	174	Chain A, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4],6Z5Y_B Chain B, Lytic Polysaccharide Monooxygenase [Phytophthora infestans T30-4]

Swiss-Prot Hits     

PYU1_T001514-p1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000230	0.999735	CS pos: 24-25. Pr: 0.9783

TMHMM  Annotations     

Start	End
7	29