CAZyme Information: PWY92867.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY92867.1
• CAZy Family: GT71
• CAZyme Description: glycosyl hydrolase, family 18

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
429		46319.77	4.5476

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000001:2693200-2694769(+)

Full Sequence      

MLKHLALGLLGLQSVAAMRFAMYIDEYHTNGLPSTDQTEGISHAIMAFAPSTLFNSDSPA
QFTPFEPVSTMRSRFGPNTKVMIAIGGWGDSSGFSQAATDETSRNRYAKNVAAMLDSHGF
DGVDIDWEYPGGNGQDYKQTPNSAKVSEITTYPLFLSAMRSAIGPNKTLSIAVPGKLGDM
IAFTPETGPQIWPSVDMVNVMTYDLMNRRNNVTMHHTSVKDSLRTIQAYADIGLEGEKTN
LGMAYYAKWFETEPGAGCDEQPLGCKTVVMENDDGSDNGKSGALTFEKSTMGAAPKDLKI
SYDGTCGADKGKCPDGQCCSQYGNCGTTSDFCQAGCLSDYGTCKGISLTDSWRAALSSGK
TDTDLGGQYYFDSPNNIFWTWDTADLIGRKFTDIVDESKLGGVMAWSLGEDTLAWEHLGA
MQEGVKGRS

Enzyme Prediction     

EC	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	21	413	1.1e-49	0.9324324324324325

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395573	Glyco_hydro_18	1.52e-76	19	411	1	307	Glycosyl hydrolases family 18.
214753	Glyco_18	1.10e-48	27	411	12	334	Glyco_18 domain.
119349	GH18_chitinase-like	1.93e-43	20	205	1	178	The GH18 (glycosyl hydrolase, family 18) type II chitinases hydrolyze chitin, an abundant polymer of beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a major component of the cell wall of fungi and the exoskeleton of arthropods. Chitinases have been identified in viruses, bacteria, fungi, protozoan parasites, insects, and plants. The structure of the GH18 domain is an eight-stranded beta/alpha barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel. The GH18 family includes chitotriosidase, chitobiase, hevamine, zymocin-alpha, narbonin, SI-CLP (stabilin-1 interacting chitinase-like protein), IDGF (imaginal disc growth factor), CFLE (cortical fragment-lytic enzyme) spore hydrolase, the type III and type V plant chitinases, the endo-beta-N-acetylglucosaminidases, and the chitolectins. The GH85 (glycosyl hydrolase, family 85) ENGases (endo-beta-N-acetylglucosaminidases) are closely related to the GH18 chitinases and are included in this alignment model.
119365	GH18_chitinase	1.44e-35	77	246	83	262	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
119351	GH18_chitolectin_chitotriosidase	9.21e-30	77	256	69	259	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR94095.1|CBM18|GH18	1.82e-255	2	428	1	430
BCS06705.1|CBM18|GH18	1.50e-252	10	428	1	422
BAE63426.1|CBM18|GH18	2.60e-225	3	429	4	431
UDD62778.1|CBM18|GH18	2.60e-225	3	429	4	431
QRD94346.1|CBM18|GH18	1.05e-224	3	429	4	431

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6TSB_AAA	2.58e-22	77	248	89	263	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
6T9M_AAA	3.20e-22	77	248	108	282	Chain AAA, Peroxiredoxin [Clostridioides difficile 630]
5GZU_A	1.48e-17	77	288	108	315	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	1.64e-17	77	288	359	566	Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
6KST_A	3.84e-16	77	246	74	257	Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32470|CHI1_APHAL	1.37e-17	27	257	50	304	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
sp|E9ERT9|CHI1_METRA	2.72e-15	78	257	122	305	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1
sp|P20533|CHIA1_NIACI	4.90e-15	77	411	153	438	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
sp|Q1E3R8|CHI1_COCIM	6.73e-14	78	303	121	355	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
sp|P0CB51|CHI1_COCPS	6.73e-14	78	303	121	355	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000267	0.999677	CS pos: 17-18. Pr: 0.9745

TMHMM  Annotations     

There is no transmembrane helices in PWY92867.1.