CAZyme Information: PWY92822.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY92822.1
• CAZy Family: GT69
• CAZyme Description: exo-beta-1,3-glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
709		76269.65	4.4907

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000001:2573274-2575626(+)

Full Sequence      

MESGFKDNYNVFRNVVKDFGADNTGSMDASAAIQAAITAGPSNGPDRSSHSMGTTGQPAI
VYLPEGTYLLKHSLQFYVGTVLVGDPTNPPTLKAEYDFADDHMIYAKDPNYGGTINFYIG
MKNIVLESNNVDPNKAITLLDWTVSQATQLTNVGFNMPRGSSHVGLTTQYDYNSNLILND
LWFSGGSVGMKLSGQQWVFKNLKFMGTTTGVIAGGTDIVFLGCQFEQGNLGIDAQGTSGS
LTVIDTTGVGMNTLISTHSSNTAGNSIVLDNILNSGPTVSVGGNAILSGNMPDTWVHGHV
YTPGDNQFQPEQGRIVTTARTPPLLSGKNYFTMAPPTYKEYDVGQILNIKNVPGKPVLGD
GQTDDTRNINDILSSNRDCTVFYFPAGTYLVTDTIFVPANTRIIGDAYASTISAVGSNFA
DESSPRSMFRVGYPGDVGVAQVSDLVFTVADVLPGCKLVEINIAAKSPGDVGFWNTHFRI
GGAVGSKVESKCTNNANDCKAAWGLLHLTTTSSAYIENMWGWTADHDLDGNNPQTISTGR
GILIEGTAATWLIGTGFEHNTLYQYNFEYARNVFTAMQQSESPYWQGQGSSALNPAPWDD
YLTSSDPDYSYCEADDSKCRMALFERIHGSSDLFLYGGCNWVFFNNGGNCDGDCQTNAIQ
VRNSTSVYMYGTNTKSTTNMAIEGTKPIARQSDNAGGWGGVLAAYLYDS

Enzyme Prediction     

No EC number prediction in PWY92822.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH55	6	705	4.4e-219	0.9567567567567568

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403800	Pectate_lyase_3	3.35e-55	12	233	1	213	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
403800	Pectate_lyase_3	1.14e-07	359	420	11	75	Pectate lyase superfamily protein. This family of proteins possesses a beta helical structure like Pectate lyase. This family is most closely related to glycosyl hydrolase family 28.
227721	Pgu1	6.88e-06	15	323	84	498	Polygalacturonase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS06656.1|GH55	0.0	1	709	110	819
BCR94046.1|GH55	0.0	1	709	110	819
CAK47731.1|GH55	0.0	1	709	236	945
QMW46035.1|GH55	0.0	1	707	123	828
QMW33981.1|GH55	0.0	1	707	123	828

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5M5Z_A	1.92e-97	8	694	24	742	Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila],5M60_A Chain A, Beta-1,3-glucanase [Thermochaetoides thermophila]
3EQN_A	4.41e-93	3	705	40	755	Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQN_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_A Chain A, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium],3EQO_B Chain B, Glucan 1,3-beta-glucosidase [Phanerodontia chrysosporium]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4B0V1|E13B_ARTBC	6.17e-98	9	705	63	873	Probable glucan endo-1,3-beta-glucosidase ARB_02077 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_02077 PE=1 SV=1
sp|P53626|E13B_TRIHA	1.08e-83	32	705	74	760	Glucan endo-1,3-beta-glucosidase BGN13.1 OS=Trichoderma harzianum OX=5544 GN=bgn13.1 PE=1 SV=1
sp|P49426|EXG1_COCCA	1.27e-79	8	671	66	750	Glucan 1,3-beta-glucosidase OS=Cochliobolus carbonum OX=5017 GN=EXG1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000055	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PWY92822.1.