CAZyme Information: PWY92018.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY92018.1
• CAZy Family: GT35
• CAZyme Description: putative beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
482		54222.68	4.6743

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000001:158244-160086(-)

Full Sequence      

MGSITTTSTLPPDFLWGFATASYQIEGAVTEDGRGPSIWDTFCKIPGKIAGGATGDVACD
SYHRTAEDIALLKECGAQAYRFSISWSRIIPLGGRNDPINADGLQHYIRFVNDLLAAGIT
PLVTLFHWDLPDELDKRYGGLLNKEEFVKDFVHYAQVVFEALAGKVKHWITFNEPWCSSV
LGYNVGQFAPGRTSDRTKSPVGDGSRECWVVGHNLLVAHGAAVRVYREEFRGVDGEIGIT
LNGDWAEPWDPSNPADVEASERKLEFTIGWFADPIYKGKYPDSMIQQLGDRLPQWTEEDI
SLVRGSNDFYGMNHYCANYIKAKTGAPDPDDTAGNLEILQQNKNGEFVGPETQSTWLRPS
PIGFRKLLKWLSERYEHPKIYVTENGTSLKGENDLPLEELLQDDFRTEYFRGYVAAMADA
SALDGVNVRAYMAWSLMDNFEWADGYETRFGCTYVDYENGQKRIPKDSAKQLRQIFDQYI
QK

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH1	8	477	8e-163	0.9836829836829837

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
274539	BGL	0.0	11	470	1	424	beta-galactosidase.
395176	Glyco_hydro_1	0.0	9	475	4	447	Glycosyl hydrolase family 1.
225343	BglB	5.48e-146	7	477	1	451	Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism].
215455	PLN02849	1.91e-107	3	469	23	473	beta-glucosidase
215435	PLN02814	1.99e-106	6	469	24	473	beta-glucosidase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS12207.1|GH1	0.0	1	482	1	482
BCS00431.1|GH1	0.0	1	482	1	482
QEV81508.1|GH1	0.0	1	482	1	482
QRD82378.1|GH1	0.0	1	482	1	482
QMW27934.1|GH1	0.0	1	482	1	482

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4MDO_A	7.84e-270	2	482	18	498	Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea],4MDP_A Chain A, Beta-glucosidase [[Humicola] grisea var. thermoidea]
6EFU_A	9.83e-244	10	482	3	465	Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],6EFU_B Crystal structure of the double mutant L167W / P172L of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
5JBK_A	1.08e-240	10	482	3	465	Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum],5JBK_B Trichoderma harzianum GH1 beta-glucosidase ThBgl1 [Trichoderma harzianum]
5BWF_A	2.17e-240	10	482	22	484	Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum],5BWF_B Crystal structure of the beta-glucosidase from Trichoderma harzianum [Trichoderma harzianum]
3AHY_A	2.78e-233	10	480	9	470	Chain A, Beta-glucosidase [Trichoderma reesei],3AHY_B Chain B, Beta-glucosidase [Trichoderma reesei],3AHY_C Chain C, Beta-glucosidase [Trichoderma reesei],3AHY_D Chain D, Beta-glucosidase [Trichoderma reesei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q25BW4|BGL1B_PHACH	5.31e-191	10	480	11	475	Beta-glucosidase 1B OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1B PE=1 SV=1
sp|Q25BW5|BGL1A_PHACH	9.11e-173	10	481	6	461	Beta-glucosidase 1A OS=Phanerodontia chrysosporium OX=2822231 GN=BGL1A PE=1 SV=1
sp|Q5Z9Z0|BGL24_ORYSJ	5.14e-144	2	473	25	499	Beta-glucosidase 24 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU24 PE=2 SV=1
sp|Q7XKV4|BGL12_ORYSJ	5.02e-143	9	469	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. japonica OX=39947 GN=BGLU12 PE=1 SV=2
sp|B8AVF0|BGL12_ORYSI	2.01e-142	9	469	38	501	Beta-glucosidase 12 OS=Oryza sativa subsp. indica OX=39946 GN=BGLU12 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000071	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PWY92018.1.