CAZyme Information: PWY92004.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY92004.1
• CAZy Family: GT34
• CAZyme Description: putative mannosyl-oligosaccharide alpha-1,2-mannosidase 1B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
511	MSFL01000001|CGC14	55811.84	4.6714

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000001:112712-114298(-)

Full Sequence      

MHVSSLSLSLTALALVSPCTAHPQSRLAQPILQKASDTQARADAVKEAFSHAWDGYYQYA
FPHDELHPVSDGYGDSRNGWGASAVDALSTAVIMRNATIVNQILDHVAKIDYSKTDSTVS
LFETTIRYLGGMLSGYDLLNGPASDLVEESSKVDVLLTQSKSLGDVLKFAFDTPSGVPYN
NLNITSGGNDGAKTNGLAVTGSLALEWTRLSDLTGDTTYAKLSQKAESYLLNPQPKSSEP
FPGLVGSNIDIATGKFTDAQVSWNGGDDSYYEYLIKMYVYDPERFGLYKDRWVAAAQSTI
QHLASHPSTRPDLTFLASYNNGNLQLSSQHLTCFDGGSFLLGGTVLNRTDFINFGLDLVN
GCHDTYNSTLTGIGPETFSWDPNSIPSSQQALFDSAGFYITSGAYILRPEVIESFYYAWR
VTGDETYREWIWSAFSSVNKYCRTGSGFAGLTNVNAADGGSRYDNQESFLFAEVLKYSYM
AFAGDAEWQVQKGSGNKFVFNTEAHPMRVST

Enzyme Prediction     

EC	3.2.1.113:12

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH47	48	509	3.3e-138	0.9977578475336323

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396217	Glyco_hydro_47	0.0	48	509	1	453	Glycosyl hydrolase family 47. Members of this family are alpha-mannosidases that catalyze the hydrolysis of the terminal 1,2-linked alpha-D-mannose residues in the oligo-mannose oligosaccharide Man(9)(GlcNAc)(2).
240427	PTZ00470	7.42e-122	17	509	44	518	glycoside hydrolase family 47 protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG17887.1|GH47	0.0	1	511	1	512
CAK37306.1|GH47	0.0	1	511	1	512
BCS05959.1|GH47	0.0	1	511	1	512
BAA08634.1|GH47|3.2.1.113	0.0	1	511	1	512
BAE57653.1|GH47|3.2.1.113	6.05e-295	1	510	1	509

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1KKT_A	6.22e-268	7	510	6	509	Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KKT_B Structure of P. citrinum alpha 1,2-mannosidase reveals the basis for differences in specificity of the ER and Golgi Class I enzymes [Penicillium citrinum],1KRE_A Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRE_B Structure Of P. Citrinum Alpha 1,2-Mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_A Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum],1KRF_B Structure Of P. Citrinum Alpha 1,2-mannosidase Reveals The Basis For Differences In Specificity Of The Er And Golgi Class I Enzymes [Penicillium citrinum]
2RI8_A	2.11e-264	39	510	3	474	Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI8_B Penicillium citrinum alpha-1,2-mannosidase complex with glycerol [Penicillium citrinum],2RI9_A Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum],2RI9_B Penicillium citrinum alpha-1,2-mannosidase in complex with a substrate analog [Penicillium citrinum]
1HCU_A	3.10e-169	33	509	7	492	Chain A, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_B Chain B, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_C Chain C, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei],1HCU_D Chain D, ALPHA-1,2-MANNOSIDASE [Trichoderma reesei]
5KKB_A	3.77e-68	45	509	26	467	Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus],5KKB_B Structure of mouse Golgi alpha-1,2-mannosidase IA and Man9GlcNAc2-PA complex [Mus musculus]
1NXC_A	4.71e-68	45	509	24	465	Structure of mouse Golgi alpha-1,2-mannosidase IA reveals the molecular basis for substrate specificity among Class I enzymes (family 47 glycosidases) [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q12563|MNS1B_ASPPH	0.0	1	511	1	512	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus phoenicis OX=5063 GN=mns1B PE=2 SV=1
sp|A2QAS2|MNS1B_ASPNC	0.0	1	511	1	512	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=mns1B PE=3 SV=1
sp|Q0D076|MNS1B_ASPTN	1.72e-303	1	509	1	507	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mns1B PE=3 SV=1
sp|B8N417|MNS1B_ASPFN	1.08e-295	1	510	1	509	Probable mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mns1B PE=3 SV=2
sp|Q2ULB2|MNS1B_ASPOR	1.08e-295	1	510	1	509	Mannosyl-oligosaccharide alpha-1,2-mannosidase 1B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mns1B PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.003216	0.996754	CS pos: 21-22. Pr: 0.8970

TMHMM  Annotations     

There is no transmembrane helices in PWY92004.1.