CAZyme Information: PWY90018.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY90018.1
• CAZy Family: GT24
• CAZyme Description: FAD-binding PCMH-type domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317WZ55]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
813		90790.12	7.3256

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000003:877948-881233(-)

Full Sequence      

MNSCLLNLLLRDSAKRETIERLWGTQATETRFDNGQRAKDANLYAYIQLCTEARTLAFHE
GGRYISLRTCQQLLAIAQQLRDGRTRDAIKRSAPLVNLCEGGGSKSKQDVSINLAARLLL
MCDFGRLPFSFSGRLHLSWTEGSLADCVRQHFSAPPVLVNTPIKLERMFMSWNIEQVAGM
DIVWTDNVVDHLRMMGGDRKVAVFHHVTFLQCQLNNTMLPPGLIQETLQTLSFLFPPNDP
GTRTWIEKNHSLRVDPRLLKCGHLRYDDRHIDNFRFWRDRLVLLKQAFDESRPQTMLQWW
WDRRDGIQCTTYPDFTIPELSQLIATLLNSRANISVLEIGPGPKSILGDLPSHLRQKVRR
YAAFEPKSIFVTRLEEWLGATEEMESPLPGLECAHDIYRVPFVLDSESGCGARVGDSGSG
SGSEEKLDIILFCHSLYGMEHQARSIARALDMLVEGGIVVVFHRDGTLRLEGLVAHRVAS
FPEGVIRIADTDEALDQFAPFIAGFVMQDIEADRITRAEWRNVCRALGGREETHPDYICF
RSPEIMVVFTRHATALPGLVAQVPLAREGRRIKNCEARFNHSAAIVRPETVRHVQLCVQW
ALEHGVGLTVVVGSHSGHCLWTNVVGVDMAAFDQVHVLVGEWKGEAGSDADSLVVAGAGS
KTGDIVRKSMAAGVTVPLGSRPSIGAGLWLQDGIGHLARLYGLACDQIVGAVMISVESGE
VFCIGCVPSQHWPVGAVRPRNEIELLWAIKGAGTNFGIVISFIFKAYVAPTYLTRSWIVS
LRDGDEARRKLHEFDTVHSTKKVSRHLSRRDTE

Enzyme Prediction     

EC	1.1.3.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA7	583	774	2.6e-32	0.37336244541484714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396238	FAD_binding_4	2.28e-15	583	711	2	126	FAD binding domain. This family consists of various enzymes that use FAD as a co-factor, most of the enzymes are similar to oxygen oxidoreductase. One of the enzymes Vanillyl-alcohol oxidase (VAO) has a solved structure, the alignment includes the FAD binding site, called the PP-loop, between residues 99-110. The FAD molecule is covalently bound in the known structure, however the residue that links to the FAD is not in the alignment. VAO catalyzes the oxidation of a wide variety of substrates, ranging form aromatic amines to 4-alkylphenols. Other members of this family include D-lactate dehydrogenase, this enzyme catalyzes the conversion of D-lactate to pyruvate using FAD as a co-factor; mitomycin radical oxidase, this enzyme oxidizes the reduced form of mitomycins and is involved in mitomycin resistance. This family includes MurB an UDP-N-acetylenolpyruvoylglucosamine reductase enzyme EC:1.1.1.158. This enzyme is involved in the biosynthesis of peptidoglycan.
223354	GlcD	2.97e-11	583	790	33	226	FAD/FMN-containing dehydrogenase [Energy production and conversion].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QPH04356.1|AA7	6.23e-12	583	774	122	294
UQC87672.1|AA7	2.18e-11	572	774	59	242
QRC92907.1|AA7	2.66e-10	583	770	64	233
QPC62667.1|AA7	8.11e-10	583	794	62	254
UPK94696.1|AA7	8.11e-10	584	774	65	236

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BVF_A	1.76e-15	585	778	42	214	Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVF_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 3 (P1) [Paenarthrobacter nicotinovorans],2BVG_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVG_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 1 (P21) [Paenarthrobacter nicotinovorans],2BVH_A Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_B Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_C Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans],2BVH_D Crystal structure of 6-hydoxy-D-nicotine oxidase from Arthrobacter nicotinovorans. Crystal Form 2 (P21) [Paenarthrobacter nicotinovorans]
6Y0R_AAA	3.70e-11	583	794	62	254	Chain AAA, Chitooligosaccharide oxidase [Fusarium graminearum PH-1]
5K8E_A	1.39e-09	561	774	34	235	Xylooligosaccharide oxidase from Myceliophthora thermophila C1 [Thermothelomyces thermophilus ATCC 42464],5L6F_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylobiose [Thermothelomyces thermophilus ATCC 42464],5L6G_A Xylooligosaccharide oxidase from Myceliophthora thermophila C1 in complex with Xylose [Thermothelomyces thermophilus ATCC 42464]
6YJO_A	5.73e-09	583	774	70	242	Chain A, FAD-binding PCMH-type domain-containing protein [Fusarium graminearum PH-1]
6FYD_A	1.11e-07	568	789	32	231	The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_B The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_C The crystal structure of EncM T139V mutant [Streptomyces maritimus],6FYD_D The crystal structure of EncM T139V mutant [Streptomyces maritimus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P08159|HDNO_PAENI	9.00e-15	585	778	41	213	(R)-6-hydroxynicotine oxidase OS=Paenarthrobacter nicotinovorans OX=29320 GN=6-hdno PE=1 SV=2
sp|Q54H55|Y8969_DICDI	1.48e-13	580	773	46	217	FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum OX=44689 GN=DDB_G0289697 PE=2 SV=1
sp|Q0CF74|AZPB3_ASPTN	3.91e-13	586	770	69	232	FAD-linked oxidoreductase ATEG_07660 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=ATEG_07660 PE=1 SV=1
sp|Q5BEJ5|AFOF_EMENI	1.59e-12	586	770	63	228	FAD-linked oxidoreductase afoF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=afoF PE=1 SV=1
sp|G3XMD0|AZAL_ASPNA	2.04e-12	586	769	65	228	FAD-linked oxidoreductase azaL OS=Aspergillus niger (strain ATCC 1015 / CBS 113.46 / FGSC A1144 / LSHB Ac4 / NCTC 3858a / NRRL 328 / USDA 3528.7) OX=380704 GN=azaL PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000056	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PWY90018.1.