CAZyme Information: PWY89348.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY89348.1
• CAZy Family: GT2
• CAZyme Description: dolichyl-phosphate-mannose--protein mannosyltransferase 4

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
770		87854.24	8.3824

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000004:1316724-1319162(-)

Full Sequence      

MSSPAPSLRKRAGKKETTPTPFYSPLSSKAAAPRPEWDYRLAIVVLTVLAFITRFYKISF
PNEVVFDEVHFGKFASYYLQRTYFFDVHPPFGKLLFALMGWLVGFDGNFLFDNIGDSYTE
HNVPYVALRAMPATLGALTVPVVFLIMWESGYSLPACVLSAGLVLFDNAHVGEDRLILLD
ASLVLAMALSILCYVRFYKLRHDEFSRKWWKWLLLTGVSLSCVISTKYVGVFTFVTIGSA
VLVDLWNLLDIRRPGGALSMVRWTQHFAARSFALIIVPFFFYLFWFQVHFAILTRSGPGD
DFMTPEFQETLSDNALAADAIGIQYYDTITMKHKDTKVFLHSHLEKYPLRYDDGRISSQG
QQVTGYPYNDTNNQWQIIPMVPFDPVETEGQMVRNGDIVQLYHLGTDTLLLTHDVASPYF
PTNQEFTTVSLEVGNGDRRNDTLFEIKIENGKPNQEFRTLSSHFKLIHFPTRVAMWTHTT
PLPDWAFKQAEINGNKNMMQTSNLWFAETIESLPEDSPRRIKEERQVKHLSFFRKYFELQ
RAMFFHNNALTSSHPYASEPFQWPFLLRGVSFWTKNDTREQIYFLGNPVGWWIASSLLAV
FAGVIGADQLSLRRGVDAVEEIWGLGARSRLYNSTGFLFLCWAAHYFPFWLMGRQRFLHH
YLPAHLASALVTGALIEFIFNLEPIPIAKAVRAEDDPSGKFKGQIGRFVSAKERMGRKSL
VAGWIATLVILGGTIYGFVFFAPLTYGTPGLDVPGILSRKWLGYDLHFAK

Enzyme Prediction     

EC	2.4.1.109:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	46	290	1.5e-71	0.9910313901345291

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224839	PMT1	0.0	38	770	22	699	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
396786	PMT	8.03e-86	44	294	1	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
406576	PMT_4TMC	2.68e-76	534	762	1	197	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
397103	MIR	1.13e-15	332	488	4	164	MIR domain. The MIR (protein mannosyltransferase, IP3R and RyR) domain is a domain that may have a ligand transferase function.
197746	MIR	9.78e-07	323	379	4	56	Domain in ryanodine and inositol trisphosphate receptors and protein O-mannosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS03793.1|GT39	0.0	2	770	3	775
BCS15407.1|GT39	0.0	2	770	3	775
CAK42948.1|GT39	0.0	2	770	3	771
QMW29154.1|GT39	0.0	3	770	4	775
QMW41228.1|GT39	0.0	3	770	4	775

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6P25_A	9.60e-104	40	767	50	730	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_A Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]
6P25_B	1.17e-98	44	750	69	737	Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor and a peptide acceptor [Saccharomyces cerevisiae W303],6P2R_B Structure of S. cerevisiae protein O-mannosyltransferase Pmt1-Pmt2 complex bound to the sugar donor [Saccharomyces cerevisiae W303]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q59X23|PMT4_CANAL	2.97e-251	35	770	43	755	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PMT4 PE=2 SV=2
sp|O42933|PMT4_SCHPO	2.75e-247	39	762	58	767	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ogm4 PE=3 SV=1
sp|P46971|PMT4_YEAST	2.50e-241	33	770	46	762	Dolichyl-phosphate-mannose--protein mannosyltransferase 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PMT4 PE=1 SV=1
sp|Q8R2R1|POMT1_MOUSE	1.56e-118	38	770	36	746	Protein O-mannosyl-transferase 1 OS=Mus musculus OX=10090 GN=Pomt1 PE=1 SV=1
sp|Q99PR0|POMT1_RAT	6.19e-118	38	770	36	746	Protein O-mannosyl-transferase 1 OS=Rattus norvegicus OX=10116 GN=Pomt1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999962	0.000030

TMHMM  Annotations     

Start	End
39	56
83	105
126	148
176	198
218	240
267	286
583	605
631	653
720	742