CAZyme Information: PWY89134.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY89134.1
• CAZy Family: GT2
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317WRQ5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
427		48110.59	7.6230

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000004:688905-690279(-)

Full Sequence      

MPLQIPSSLRFLAVGAALSLLLTTFLVFYAHSSSNDVAKYALKTASQNPDCLSSSSNTTD
SDWEFISSRDADNLGLSETQCRRAFPKLFYELDKSVASRKDKPITLKELESSPVEDGMVR
GVIDRGELYILDFAPQPHTFTRAKSTLHALHRSLTSDPSRHTLPTISFLLTTDDLPPSTS
SSSSITTPPIWSYTKQDHHTHVWLIPPFTHWTWPEVDIPPYRTVRHQITTLESALPFEHK
TKQLLWRGAIAPNPPVRNALLAAARGQSWSSIHPLDWASPASLQATRLPISEHCRYQFLA
HTEGRSFSGRGAYLLNCRSVLISHPLVWRELHHAALVKTGPEMNYVEVKGDWSDLGDKMR
FLLGNEEVAEGIAARAVRVFRERYLTPAAEACYWRELVRGWARVGRFEGVGEGRERGVPF
EEWVLMN

Enzyme Prediction     

No EC number prediction in PWY89134.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	163	405	4.2e-24	0.984

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	2.98e-13	192	408	35	256	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	5.09e-11	206	408	124	326	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13796.1|GT0	5.70e-157	7	425	9	439
BCS02108.1|GT0	5.70e-157	7	425	9	439
QQK47628.1|GT0	1.00e-153	8	427	7	436
UDD61446.1|GT0	2.85e-151	9	425	11	436
QMW41857.1|GT0	5.93e-146	9	425	11	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	7.30e-11	189	403	118	340	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q8BYB9|PGLT1_MOUSE	4.39e-11	161	403	120	368	Protein O-glucosyltransferase 1 OS=Mus musculus OX=10090 GN=Poglut1 PE=1 SV=2
sp|G3V9D0|PGLT1_RAT	1.85e-10	163	403	122	368	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	4.38e-10	189	403	146	368	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	2.44e-09	189	403	146	368	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999940	0.000074

TMHMM  Annotations     

Start	End
7	29