CAZyme Information: PWY87720.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY87720.1
• CAZy Family: GT90
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
472		53737.89	6.1300

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000006:1043985-1045403(+)

Full Sequence      

MGASLVWRRKLLRFVVLSCLVTSFTIFLWPRFDFHRVTTQTVSNITITSEVDCEPDFNAL
RRLNVEKLSQYVRREVVAVESPSDSLPIAQSLDAPLFQKKPKDDFHHPSPEYLHDDCLIP
QPVSVQVLAPPKRADASHIDFGVATTLERLNDSLDAFSHWAGYTNARIFALIEPDDRTPQ
VLLKADALGINLSVSESSEEYQRRYFSLVPHLAKNMRSTTKWSCVMDDDTFFPSMSALIK
GLKEYDHTKQTYVGGLSESIPQVGVFGLMGFGGAGVFLSPSLIQELSRPEVFEDCQRMDF
TGDRRISLCIYQYTAARLTIDHRLRQLDMMGDVSGFFEAERPPPLSVHHWKSWFHADMAK
ASAVTEVCGDTCFLRQWHFGDGWVLTNGFSVVKYSNEKKPGDRTMELTWDSHNGAVFESY
LHELGPLRPRDDGKISYLHEDALVDGNQVHQWYIHRDAEKGDRVLELIWRSG

Enzyme Prediction     

No EC number prediction in PWY87720.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
215605	PLN03153	1.55e-08	218	349	209	341	hypothetical protein; Provisional
367085	Fringe	1.91e-06	137	353	4	231	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
398362	DUF604	5.07e-05	269	349	9	90	Protein of unknown function, DUF604. This family includes a conserved region found in several uncharacterized plant proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96997.1|GT31	4.53e-293	4	471	11	478
BCS09474.1|GT31	4.53e-293	4	471	11	478
CAK44690.1|GT31	3.20e-277	8	453	3	448
BAE58287.1|GT31	7.86e-249	1	471	12	484
UDD56605.1|GT31	7.86e-249	1	471	12	484

PDB Hits     

PWY87720.1 has no PDB hit.

Swiss-Prot Hits     

PWY87720.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000004

TMHMM  Annotations     

Start	End
12	29