CAZyme Information: PWY87450.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY87450.1
• CAZy Family: GH72|CBM43
• CAZyme Description: TPT-domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
585		66070.74	7.8330

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000006:211165-215179(-)

Full Sequence      

MIPQSPRASGLQWLTAQFSRRRFQLSLAVATTISLFYFLRLNFLPTDYDTPFHNTPYARS
LSARDLLARPLSDDITTIPKIIHQTWFPAGSNMSENAQAWVQTMREQNPDWEYVLWDDET
NRMLVEQYFPWFLTDYLRLPKEIHRADVVRNLYMYRFGGMYADVDTEALRPVEGLFTGHA
TSLDKHTRTLSGYSKNKDTTQRGFVGHMAHKPGLDGPAAVPNGWMASPPGHPFWLLPVIH
VIENPNGNGDGSVESLTGPGALADMLRKYYTESWVFWSNLTILFNKWVIESTEFRYPIIL
TTWHLIFATLATQLLARTTTMLDGRKKIKMDGRTYLRMIIPIGILYSGSLVCSNIVYLYL
NVSFIQMLKAGGPIITLLTTWLWRLSHPSLESFINILIIALAVSLAVAGEVQFSWLGVLF
QLSALFFDANRLVMIQILVSDEGQKMDPLVTLYYSAPVCAFTNFLIACATEMREFRWAVV
PETGWGVLMANAAVGFMLNVSIFVLIGKTSGLTMTLVSVPKNILLIVCSVLIWGTVISGL
QIFGYTIALLGLLYYSVGWQTIKSRYDAGYTRLVGHDKLQDGENV

Enzyme Prediction     

No EC number prediction in PWY87450.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	97	175	1e-18	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	2.32e-22	76	269	80	243	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	1.32e-14	101	171	8	82	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.
411044	TPT_S35C2	1.01e-12	333	552	2	231	solute carrier family 35 member C2, member of the triose-phosphate transporter family. Solute carrier family 35 member C2 (S35C2 or Slc35c2), also called ovarian cancer-overexpressed gene 1 protein (OVCOV1), is a member of the triose-phosphate transporter (TPT) family, which is part of the drug/metabolite transporter (DMT) superfamily. It may function either as a GDP-fucose transporter that competes with Slc35c1 (S35C1) for GDP-fucose, or a factor that otherwise enhances the fucosylation of Notch and is required for optimal Notch signaling in mammalian cells.
308657	TPT	1.08e-12	274	556	10	290	Triose-phosphate Transporter family. This family includes transporters with a specificity for triose phosphate.
129898	tpt	1.18e-12	294	565	28	302	Tpt phosphate/phosphoenolpyruvate translocator. The 6-8 TMS Triose-phosphate Transporter (TPT) Family (TC 2.A.7.9)Functionally characterized members of the TPT family are derived from the inner envelope membranes of chloroplasts and nongreen plastids of plants. However,homologues are also present in yeast. Saccharomyces cerevisiae has three functionally uncharacterized TPT paralogues encoded within its genome. Under normal physiologicalconditions, chloroplast TPTs mediate a strict antiport of substrates, frequently exchanging an organic three carbon compound phosphate ester for inorganic phosphate (Pi).Normally, a triose-phosphate, 3-phosphoglycerate, or another phosphorylated C3 compound made in the chloroplast during photosynthesis, exits the organelle into thecytoplasm of the plant cell in exchange for Pi. However, experiments with reconstituted translocator in artificial membranes indicate that transport can also occur by achannel-like uniport mechanism with up to 10-fold higher transport rates. Channel opening may be induced by a membrane potential of large magnitude and/or by high substrateconcentrations. Nongreen plastid and chloroplast carriers, such as those from maize endosperm and root membranes, mediate transport of C3 compounds phosphorylated atcarbon atom 2, particularly phosphenolpyruvate, in exchange for Pi. These are the phosphoenolpyruvate:Pi antiporters (PPT). Glucose-6-P has also been shown to be asubstrate of some plastid translocators (GPT). The three types of proteins (TPT, PPT and GPT) are divergent in sequence as well as substrate specificity, but their substratespecificities overlap. [Hypothetical proteins, Conserved]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10897.1|GT32	1.53e-143	1	272	2	274
BCR98563.1|GT32	1.53e-143	1	272	2	274
EAA61879.1|GT32	1.46e-140	66	558	135	734
CAK38227.1|GT32	3.26e-103	93	272	1	182
QRD92713.1|GT32	1.78e-99	19	270	11	262

PDB Hits     

PWY87450.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9LFN3|PT511_ARATH	1.24e-47	260	556	5	306	Probable sugar phosphate/phosphate translocator At5g11230 OS=Arabidopsis thaliana OX=3702 GN=At5g11230 PE=2 SV=1
sp|Q3E6T0|PT525_ARATH	4.32e-46	260	556	10	306	Probable sugar phosphate/phosphate translocator At5g25400 OS=Arabidopsis thaliana OX=3702 GN=At5g25400 PE=2 SV=1
sp|Q9SUV2|PT432_ARATH	8.51e-46	260	556	5	306	Probable sugar phosphate/phosphate translocator At4g32390 OS=Arabidopsis thaliana OX=3702 GN=At4g32390 PE=3 SV=1
sp|Q9SKJ7|PT225_ARATH	7.37e-43	260	556	10	306	Probable sugar phosphate/phosphate translocator At2g25520 OS=Arabidopsis thaliana OX=3702 GN=At2g25520 PE=1 SV=1
sp|Q9LRP2|PT317_ARATH	6.54e-36	265	556	10	300	Probable sugar phosphate/phosphate translocator At3g17430 OS=Arabidopsis thaliana OX=3702 GN=At3g17430 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000008	0.000005

TMHMM  Annotations     

Start	End
294	316
336	358
363	385
392	409
413	435
448	470
485	507
514	536
540	562