CAZyme Information: PWY87421.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY87421.1
• CAZy Family: PL1
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
480	MSFL01000006|CGC1	54702.17	6.5413

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000006:123199-124696(-)

Full Sequence      

MGREPSHRRRPYPAILSRRVTSILALILFLVVGASVFKDQLGSGPFDPSSLYHLHSKHGP
DFWDWETTTRFPRVQSTLLDEDQLCDAFPSYLLSRIQVVLKIGASEPADRVDAQIASVTR
CIPNLIIVSDRESHIKGHRVHDILASLPLSFRANTSDFDAYEALQRGDDRLVGGPQGWRL
DRFKFLPMVERAHEINPTADWFVFLESDTYVVWDNMFRFLDQFDPQVPHYMGSPSPGRQL
SEKEISYFAYGGSGFVLSTAAVQKLVFREIGPHGEYIQPPLSQQYEELIKADCCGDSILG
WALHEKGVPVSGYWPMFNPHPLHGIPFDDAYWCQPVISMHKTMFSDMMGLMRWENQRDRT
RPLLYADLLEYLKLGTVDHMADWDNGDWGGWQEPPESPAHGSFDACRAACHDNALCLSFT
YDSSGHCVFVRTMRLGAKKKLGDSTVRLSSGWDLEKIQTWRASHQCEKAMWVKPSTKRIF

Enzyme Prediction     

No EC number prediction in PWY87421.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
367085	Fringe	3.39e-06	201	273	87	167	Fringe-like. The drosophila protein fringe (FNG) is a glucosaminyltransferase that controls the response of the Notch receptor to specific ligands. FNG is localized to the Golgi apparatus (not secreted as previously thought). Modification of Notch occurs through glycosylation by FNG. The xenopus homolog, lunatic fringe, has been implicated in a variety of functions.
238531	PAN_AP_plant	0.002	395	428	26	60	Plant PAN/APPLE-like domain; present in plant S-receptor protein kinases and secreted glycoproteins. PAN/APPLE domains fulfill diverse biological functions by mediating protein-protein or protein-carbohydrate interactions. S-receptor protein kinases and S-locus glycoproteins are involved in sporophytic self-incompatibility response in Brassica, one of probably many molecular mechanisms, by which hermaphrodite flowering plants avoid self-fertilization.
215605	PLN03153	0.004	173	258	189	270	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS10791.1|GT31	1.19e-317	1	480	1	481
BCR98451.1|GT31	1.19e-317	1	480	1	481
CAK49077.1|GT31	9.34e-308	1	466	1	467
UDD57328.1|GT31	3.25e-248	15	480	5	477
QRD83812.1|GT31	4.61e-248	15	480	5	477

PDB Hits     

PWY87421.1 has no PDB hit.

Swiss-Prot Hits     

PWY87421.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.996887	0.003114

TMHMM  Annotations     

Start	End
20	37