CAZyme Information: PWY87385.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY87385.1
• CAZy Family: GH72
• CAZyme Description: 1,3-beta-glucanosyltransferase [Source:UniProtKB/TrEMBL;Acc:A0A317WMX4]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544		57387.96	3.7362

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000006:40818-42659(+)

Full Sequence      

MKLAATIAAAALLDLAVATAPAIVIKGSKFFYENNGTQFYIRGVAYQPPYDDDGTTTSAG
TVDYVDPLANETICKRDIPYLQELNANVVRVYDVDPDADHSTCMNLLADAGIYVLADLSS
ADYSIDSTDPQWNLELYNYYASVVDSLANYTNTMGFFAGNENSDSANTTGASAYVKAAVR
DMKAYIKSKDYRSIGVGYSAADVSEIRTDLANYFNCGDSDDAVDFFGDNVYEWCGDSSYT
ESGYDTITDEFANYSVPYFFSEYGCITVQPRSFSNVPVMYGPKMDYWLSGGVVYEYFQDA
NDYGLVTISDGAVSTLTGFSSYSEEIATATPTGTNSASYTPTNTEARACPTVGASWDASS
VLPPAPNAELCACMEETLACVVKTSVSTEKYADLYGTVCGYGVCGGIETNATSGEYGAYS
MCETKQMLNWALNAYYEENKAAGGTSACDFGGSATITSTTSPTGTCSSMLKEIGTAGTGT
ISLTAAAGTSTGDASSSDSTSSSSSESSSAGVPGYMTYTSTLGLGQLAVYVAVGLLSGTG
MIFL

Enzyme Prediction     

EC	2.4.1.-:3	2.4.1.-:33

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH72	18	327	1.3e-126	0.9839743589743589
CBM43	380	467	8.3e-20	0.9759036144578314

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397351	Glyco_hydro_72	7.35e-144	21	329	10	314	Glucanosyltransferase. This is a family of glycosylphosphatidylinositol-anchored beta(1-3)glucanosyltransferases. The active site residues in the Aspergillus fumigatus example are the two glutamate residues at 160 and 261.
400371	X8	2.83e-25	378	455	1	76	X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains.
197867	X8	8.41e-20	380	468	3	85	Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAL00327.1|CBM43|GH72	1.06e-316	1	544	1	541
BCS10726.1|CBM43|GH72	2.12e-297	1	544	1	540
BCR98382.1|CBM43|GH72	6.84e-228	104	544	1	436
BCR92255.1|CBM43|GH72	7.46e-196	1	479	1	473
EAL84955.1|CBM43|GH72	1.21e-192	1	482	1	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2W62_A	2.41e-105	21	436	34	456	Saccharomyces cerevisiae Gas2p in complex with laminaripentaose [Saccharomyces cerevisiae],2W63_A Saccharomyces Cerevisiae Gas2p In Complex With Laminaritriose And Laminaritetraose [Saccharomyces cerevisiae],5O9O_A Crystal structure of ScGas2 in complex with compound 7. [Saccharomyces cerevisiae S288C],5O9P_A Crystal structure of Gas2 in complex with compound 10 [Saccharomyces cerevisiae S288C],5O9Q_A Crystal structure of ScGas2 in complex with compound 6 [Saccharomyces cerevisiae S288C],5O9R_A Crystal structure of ScGas2 in complex with compound 9 [Saccharomyces cerevisiae S288C],5O9Y_A Crystal structure of ScGas2 in complex with compound 11 [Saccharomyces cerevisiae S288C],5OA2_A Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_B Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA2_C Crystal structure of ScGas2 in complex with compound 8 [Saccharomyces cerevisiae S288C],5OA6_A Crystal structure of ScGas2 in complex with compound 12 [Saccharomyces cerevisiae S288C]
2W61_A	6.73e-105	21	436	34	456	Saccharomyces cerevisiae Gas2p apostructure (E176Q mutant) [Saccharomyces cerevisiae]
5FIH_A	6.73e-105	21	436	34	456	SACCHAROMYCES CEREVISIAE GAS2P (E176Q MUTANT) IN COMPLEX WITH LAMINARITETRAOSE AND LAMINARIPENTAOSE [Saccharomyces cerevisiae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P0C956|GEL4_ASPFU	4.19e-173	1	476	1	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel4 PE=3 SV=1
sp|B0XVI5|GEL4_ASPFC	4.19e-173	1	476	1	489	1,3-beta-glucanosyltransferase gel4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel4 PE=1 SV=1
sp|P0C955|GEL3_ASPFU	2.20e-169	24	482	17	477	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gel3 PE=3 SV=1
sp|B0XT09|GEL3_ASPFC	2.43e-169	24	482	17	477	1,3-beta-glucanosyltransferase gel3 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=gel3 PE=1 SV=1
sp|D4ATC3|GAS1_ARTBC	2.86e-162	27	482	43	498	1,3-beta-glucanosyltransferase ARB_07487 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_07487 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000242	0.999740	CS pos: 18-19. Pr: 0.9757

TMHMM  Annotations     

There is no transmembrane helices in PWY87385.1.