CAZyme Information: PWY86725.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY86725.1
• CAZy Family: GH55
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
611		65502.93	5.0493

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000007:274010-275895(-)

Full Sequence      

MSITEADIVIIGGGTAGLTLAARLSENPNLQVLVLEAGQDQTDDPRVQTPALWPALVATD
SDWKFMTAPQTALHGKQIPLPQGRMLGGSSAMNGMAFIANSKANVNAWGALGNPGWDWDT
ISPYYKKVFTLTLPSEEKRKELGLEYVDESVNGNNGPIHASFPDALVDPIANAWVESLRG
LGYPMSTDPFSGDARGGYTNAATIDPITKTRSYSANAYYLPAKARQNLHVITGASVNKIL
LDPLPNGDASATGVEYTKDNSIFTVTSNREVILSAGTFNSPKLLELSGIGSRGALETLNI
PVIIDNPNVGENLQDHVLSGLSLEVEDFIATKDDLMRRVPEVLSAAMESYKTRQFGPFTI
GGNYSSALLPLPDLSSSEERATILATTTTTTNTPLPTHTDPFAANLTSFVRSVLTTPTEP
TGGYFTYPAQSDFKGSGLSTQTIESKFPENYITICAFLLHPLSRGTCHISSTNPADPPVI
DPRYLTHPTDLEMLARHTRLIDTIAASQPLASMLKSGGKRSPGAPDDLRTAPLDEVKEYV
RCAGKSTFHPTSTCAMMPREKGGVVDSRLRVWGVGGLRVVDASVIPIVPRGNTQSAVYAV
AERAADLIRED

Enzyme Prediction     

No EC number prediction in PWY86725.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	5	611	2e-184	0.9964788732394366

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	8.05e-101	5	611	7	536	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	6.60e-100	1	609	1	532	choline dehydrogenase; Validated
398739	GMC_oxred_C	7.81e-43	461	604	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	3.18e-34	80	316	21	216	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	8.70e-22	7	597	57	565	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QKX53653.1|AA3_2	1.77e-301	5	611	6	610
ANH22750.1|AA3_2	9.66e-291	4	611	42	644
VBB80802.1|AA3_2	1.69e-221	4	611	3	608
CDP29061.1|AA3_2	2.39e-221	4	611	3	608
CAK46356.1|AA3_2	2.91e-186	5	611	10	601

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4YNT_A	4.36e-89	1	611	1	567	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
6ZE2_A	1.18e-81	9	611	9	585	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
5OC1_A	2.98e-74	5	611	1	564	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.40e-73	5	611	2	565	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6O9N_A	2.54e-72	5	611	35	641	Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus],6O9N_B Structural insights on a new fungal aryl-alcohol oxidase [Thermothelomyces thermophilus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A5C1RDA6|ASC9_DIDFA	4.36e-97	7	611	15	619	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	1.77e-96	2	611	36	632	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	8.54e-96	7	608	48	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1
sp|Q5GMY3|GMCH_MALSM	8.54e-96	7	608	48	615	GMC oxidoreductase family protein Mala s 12.0101 OS=Malassezia sympodialis OX=76777 PE=1 SV=2
sp|A0A161CEV4|CITC_MONRU	7.75e-94	4	611	12	611	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000006	0.000024

TMHMM  Annotations     

There is no transmembrane helices in PWY86725.1.