CAZyme Information: PWY86229.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY86229.1
• CAZy Family: GH55
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		46824.91	5.9804

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000008:904394-905827(-)

Full Sequence      

MLLPKGGVTWKSAKARLPPWRAVLFLVTRTRFLVSLAITGLVVLLWRGISKSASEMQSFY
CYGPSKSPMEMSINEMVEWSAHTQTPVLFNHHDPYEVNSSSIKTVDLNPIKSTTQAVSNS
ERVLILTPLRDASEHLVNYFNLLYKLTYPHDLIDLAFLVGDSSDDTIAVLTAELARIQDQ
VDEKIAFRSATIVQKDFGADTEMNVEDRHSFAAQGPRRKAIGRARNYLLYSALKPDHSWV
YWRDVDIFDSPASILEDFIAHDRDVLVPNIWFHRYRDGVDVEGRFDYNSWIESDKGRRLR
ETLDPNTVLAEGYKEYDTGRTYLVGMGDWRKNKDEEVELDGIGGVNILVKADVHRTGINF
PAYAFENQAETEGFARMAKRAGYQVYGLPNYVVWHIDTDEKPGNLGDRKAY

Enzyme Prediction     

No EC number prediction in PWY86229.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT62	99	363	1.7e-108	0.9888059701492538

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397491	Anp1	2.72e-152	101	364	1	265	Anp1. The members of this family (Anp1, Van1 and Mnn9) are membrane proteins required for proper Golgi function. These proteins co-localize within the cis Golgi, and that they are physically associated in two distinct complexes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38583.1|GT62	1.91e-298	1	411	1	411
BCS12574.1|GT62	1.11e-297	1	411	1	411
BCS00814.1|GT62	1.11e-297	1	411	1	411
BCS29009.1|GT62	8.30e-272	1	411	1	409
BAE59398.1|GT62	2.88e-270	1	411	1	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3ZF8_A	2.98e-63	106	399	10	303	Crystal structure of Saccharomyces cerevisiae Mnn9 in complex with GDP and Mn. [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P32629|ANP1_YEAST	4.90e-98	88	396	48	355	Mannan polymerase II complex ANP1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ANP1 PE=1 SV=3
sp|O74745|ANP1_SCHPO	6.29e-96	99	396	74	372	Mannan polymerase II complex anp1 subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=anp1 PE=3 SV=1
sp|P23642|VAN1_YEAST	2.23e-77	100	396	170	512	Mannan polymerase I complex VAN1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAN1 PE=1 SV=3
sp|Q00314|VAN1_CANAX	2.92e-74	96	396	70	419	Vanadate resistance protein OS=Candida albicans OX=5476 GN=VAN1 PE=3 SV=1
sp|P53697|MNN9_CANAL	4.92e-65	102	397	73	367	Mannan polymerase complex subunit MNN9 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MNN9 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999999	0.000008

TMHMM  Annotations     

There is no transmembrane helices in PWY86229.1.