CAZyme Information: PWY84463.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY84463.1
• CAZy Family: GT4
• CAZyme Description: endoplasmic reticulum-resident kdel protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
456	MSFU01000002|CGC2	52412.89	7.1008

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000002:1574189-1575625(+)

Full Sequence      

MGRRMQFSAFHIFTLALAAVLGISIWSLWLGVNSDRDNIHPLLNQLIPAGHCACHTAAIF
ECDSCLRCPAQLPFHDTVSSSSAPPTQTFFDPLEYSYNETQCTNLFPGLFEDPIRAQSFW
TARHGIKRTDIDNIKMVDGMARVAIYQGRLYVLRAMAKGEDHRRKILGILASIHRAIVSA
PQLAVIPNTEIVFSVEDKLEDIAGPNHPLWVLARKATEESVWLMPDFGFWSWGHVDTQIG
PYDEVVKHVEENELPWDEKENKLVWRGKLSFAPKLRRALLEIARNYAWGDVKEVEWKNKA
NYLSMDNHCDYRFIAHVEGRSYSASLKYRQACRSVVVIHKLQYIQHHHYLLVSSGPQQNF
VQVERDWTDLPHKIQELLDNPIKARMIADNNVDIFRERYLTPAADTCYWRALLQGWTTAS
PQITETMSDPTNVSNKGIRYESYLLLDPSSMMRFRP

Enzyme Prediction     

No EC number prediction in PWY84463.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	186	417	5.9e-19	0.972

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	1.27e-19	142	414	40	317	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	6.45e-17	186	416	2	249	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW35140.1|GT0	1.89e-307	1	454	1	453
QRD91520.1|GT0	1.89e-307	1	454	1	453
QMW31874.1|GT0	4.90e-210	17	454	19	454
QRD90937.1|GT0	4.90e-210	17	454	19	454
UDD60835.1|GT0	1.99e-209	17	454	19	454

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F84_A	5.05e-07	181	414	123	373	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|B0X1Q4|RUMI_CULQU	9.02e-09	181	414	132	383	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q16QY8|RUMI_AEDAE	1.16e-07	181	414	133	382	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|A0NDG6|RUMI_ANOGA	8.33e-07	124	414	88	380	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1
sp|Q8T045|RUMI_DROME	2.65e-06	181	414	135	385	O-glucosyltransferase rumi OS=Drosophila melanogaster OX=7227 GN=rumi PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999426	0.000589

TMHMM  Annotations     

Start	End
7	29