CAZyme Information: PWY83342.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY83342.1
• CAZy Family: GH36
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
518	MSFL01000010|CGC4	57978.47	5.8375

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000010:99692-102380(+)

Full Sequence      

MPRPSLKQPRRPWCIAISIALALVVIIVIVVPCAVILTRKSHGERSNVLFPLYIYPTNDS
TWDPLYDSVSAHPDLNFTVIINPDSGPGSSAYPSDAYVTNIERLGTYANVRKVGYVRTGY
ATRNISTVLAEVSTYAGWANRSLTLAMDGIFFDEAPYDYSAAKVEYMDTINEAVKDSSGF
RRDRLVIHNPGTIPDSRYNANTTDVTVVFESSYQDFDSERHSLSALASDRTGYAYMLHSV
PDTLSNGTLRKFVDKMSRKAEYLFLTTLSEDYYESFDPAGATICDVMPTIAAYPHLEFLV
IINPNSGPGALPSPDANYAREVARLNACPNVYTVGYIRIDYCRKPLAKTFEEIDRYASWA
AEHATSGLGVGGIMVDETPNHYAATAADYLNALHQHVKASPGLLRDRLVVHNPGTPPDYT
MADPGPDLILVCEEPHVRFRSNEVQHRLRELHYDRLRCGYMITEVPREEIRPLVHDLRHR
AAYVFVTEIVGDFYERFGPYSWGALMEALSLQSVQSEK

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH135	48	279	2.5e-83	0.9662447257383966
GH135	287	507	7.7e-67	0.919831223628692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
403383	Spherulin4	1.81e-103	53	287	1	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.
403383	Spherulin4	1.47e-79	289	509	15	238	Spherulation-specific family 4. This protein is found in bacteria, archaea and eukaryotes. Proteins in this family are typically between 250 and 398 amino acids in length. There is a conserved NPG sequence motif and there are two completely conserved G residues that may be functionally important. Starvation will often induce spherulation - the production of spores - and this process may involve DNA-methylation. Changes in the methylation of spherulin4 are associated with the formation of spherules, but these changes are probably transient. Methylation of the gene accompanies its transcriptional activation, and spherulin4 mRNA is only detectable in late spherulating cultures and mature spherules. It is a spherulation-specific protein.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EHA25033.1|GH135	1.02e-278	36	510	1	476
BCS14736.1|GH135	2.90e-164	1	289	1	289
GAA87859.1|GH135	2.90e-164	1	289	1	289
BCS03090.1|GH135	2.90e-164	1	289	1	289
CAK41390.1|GH135	2.89e-156	1	278	66	343

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D6T_A	2.21e-63	36	287	14	270	Crystal Structure of Aspergillus clavatus Sph3 in complex with GalNAc [Aspergillus clavatus NRRL 1]
5C5G_A	2.70e-62	43	276	5	241	Crystal Structure of Aspergillus clavatus Sph3 [Aspergillus clavatus NRRL 1]

Swiss-Prot Hits     

PWY83342.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000019	0.000023

TMHMM  Annotations     

Start	End
13	35