CAZyme Information: PWY82665.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY82665.1
• CAZy Family: GT22
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376	MSFU01000003|CGC6	41244.89	4.9632

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000003:1136053-1137183(-)

Full Sequence      

MSTMLTRPTAILIFSLVFLNLYLFHRLIRQPVVPISPTLVPTPSPAAAEIQEIHLPPQQP
PQITTTITEDPTTLFPTTTLATITTTSTSTTTTKTTTHPHKTHPQPTSHSIPHKLWQKTG
TKGLTEQAESWISTWTTLNPHLRHEILTETSSLAYVETNFRPIWPEIADLYTSLSVPILR
ADLLRLLILYIDGGIWSDLDVSCEVPISQWPIPPTANVVVGIEFDGWQFASWTVMSTPGN
GHIYHAIEYVAGRLEGLARENNVTVGEVTMEMIPDVVDVTGPQAITVSLLETISEEVGRG
VGKEEIEGIGEGGVLLGDVLVLPQASFAALQGGMPQGQGEYLVSHHYAGSWKNEVGGEEG
VKEDDGGRSRMGRRRW

Enzyme Prediction     

No EC number prediction in PWY82665.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	129	211	2.9e-17	0.9222222222222223

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	9.36e-16	111	239	82	232	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	6.11e-11	129	212	9	88	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK40793.1|GT32	2.85e-209	4	364	1	356
BCS30122.1|GT32	1.06e-89	108	364	108	369
EAA62114.1|GT32	1.09e-88	10	360	14	366
QQK40626.1|GT32	2.72e-83	110	358	92	341
BCS04855.1|GT32	8.15e-82	235	364	1	130

PDB Hits     

PWY82665.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	3.40e-16	106	354	137	396	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	1.33e-10	108	354	96	378	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.47e-10	111	353	130	389	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	9.39e-09	111	240	96	272	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000061	0.000000

TMHMM  Annotations     

Start	End
5	24