CAZyme Information: PWY80554.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY80554.1
• CAZy Family: GH28
• CAZyme Description: Fn3_like domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317W1V2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1048	MSFL01000014|CGC1	115520.45	4.8525

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000014:203631-206877(-)

Full Sequence      

MPLPFQASGRKSSQHQRYTPLHESIPEEVHNDRRYSDTLTLSDLSEPDLNESDDSNVKLR
RVDHARNPSQATAYAPAPDRRSTDVEAYLDSITEAEQELLSAARQYELTDDSEDEDYVVK
KKGHRRRTSSFRRHTPRTGWRAYYYSRWLWWTLVVIFVALGLMVWGFLNRAWSGDPDRMD
MTPSESWFPTPKGGALENWAEDYRKAEMMVRDMTLIEKINVTTGIGWQMGLCVGNTGPAE
FVKFPSLCLQDGPLGLRYADLISAFPAGITTGATWNRELIRQRGEAMGEEARLKGVNVLL
GPSMGAIGMMPAGGRNWEGFGSDPVLQGVAAAETIRGIQSRGVMATAKHFVLNEQEHFRQ
PLEWGIASAMSSNVGDRALHEVFVWPFAESIRADVASVMCAYQMVNNSHACENSKLLNGI
LKDELGFQGFVQSDWLAQRSGINSALGGLDMSMPGDGLLWADGRSLWGAELTRAVLNTSV
PMERLNDMVTRIVAAWYHLGQDYWERPPPEGDGGPNFSSWTNDQVGWLHQGSPDDEAYGI
VNRFINAQGEGADAHGIIARRVAAEGIVLVKNDKNTLPLSRRPSVSSGVYRVGVYGDDAG
PAQGPNACPDRGCNQGTLAMGWGSGTVEMPYLVSPIEALQSAWASEVEVHPYLRNAVMPA
DAADKNLCLVFANADSGEGFISAGGIHGDRNHLFLQKGGDSLIQTVASSCGGPTVVVVHA
VGPVVVESWIDIPGVEAVLFAHLPGQESGNALMDVLFGEVDASGRLPYTVGKSLADYGPA
AQVLYEPNAPVPQVDFSDGLYIDHRYFDRHNITPRFEFGFGLSYTTFELADLRVNALQPK
SQLPAPRPGQTVYPPEYDSEPPRNESVFFPAGFQVVSKYIYPYLPSLQGTEAANYTHYPK
GYNQVQTPSEAGGGLGGNPSLYEEMAQVEVQVRNTGSREGQTVVQAYVSFPDEVTEDGDW
VEVHQGARSPRKVKLERMPEKIDFPVRVLRNFSKVALGVGEEQTVSMSLSRKDLSYWSVR
QQNWVMPEGDFTIWVGSSSRDLPLRENF

Enzyme Prediction     

EC	3.2.1.21:13

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	243	454	4.9e-57	0.9629629629629629

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
224389	BglX	6.97e-49	263	619	81	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
396478	Glyco_hydro_3_C	5.47e-41	567	824	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
185053	PRK15098	6.09e-40	265	1041	120	756	beta-glucosidase BglX.
395747	Glyco_hydro_3	6.55e-30	265	492	88	313	Glycosyl hydrolase family 3 N terminal domain.
405066	Fn3-like	4.96e-22	943	1039	2	71	Fibronectin type III-like domain. This domain has a fibronectin type III-like structure. It is often found in association with pfam00933 and pfam01915. Its function is unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02242.1|GH3	0.0	1	1045	1	1042
BCS13924.1|GH3	0.0	1	1045	1	1042
CAK42292.1|GH3	0.0	162	1040	1	878
QMW37281.1|GH3	0.0	2	1048	3	1048
QMW25221.1|GH3	0.0	2	1048	3	1048

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5FJI_A	4.64e-241	184	1045	6	837	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
5FJJ_A	6.14e-241	180	1045	3	835	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
4IIB_A	1.07e-232	184	1045	6	834	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
6SZ6_A	1.14e-230	184	1044	4	831	Chain A, Beta-glucosidase [Thermochaetoides thermophila]
5JU6_A	1.60e-230	184	1045	25	848	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A1CMH6|BGLE_ASPCL	0.0	8	1048	24	1050	Probable beta-glucosidase E OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglE PE=3 SV=1
sp|Q5AYH8|BGLE_EMENI	0.0	18	1048	5	1021	Probable beta-glucosidase E OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglE PE=3 SV=1
sp|B0YD91|BGLE_ASPFC	0.0	16	1048	29	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=bglE PE=3 SV=1
sp|Q2UTX5|BGLE_ASPOR	0.0	2	1048	3	1048	Probable beta-glucosidase E OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=bglE PE=3 SV=2
sp|Q4WD56|BGLE_ASPFU	0.0	16	1048	29	1033	Probable beta-glucosidase E OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=bglE PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000070	0.000000

TMHMM  Annotations     

Start	End
147	169