CAZyme Information: PWY79298.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY79298.1
• CAZy Family: GH27
• CAZyme Description: rhamnogalacturonase rhgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
544	MSFL01000016|CGC2	56719.48	3.9854

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000016:555433-557247(-)

Full Sequence      

MVAKLSFLSFLGLAPLFAAAQLSGSVGPLTSAATKAATKTCNVLDYGAVADKSTDLGAPL
ASAFAECKSGGLVYVPEGDYAISTWARLSGGEAWALQIDGIIYRDSDTGGNMIYIEHSTD
FELFSSTSAGAFQGLGYELHAEDNWEGPRLLRLYEVTDFSIHDFILVDSPSFHLSLDTCA
NGEVYNMAIRGGDHGGLDGIDVWSTNIWVHDVEVTNKDECVTVKSPAKNILVESIYCNWS
GGCGMGSFGSDTNVSDIVYRDIYTWSSNNMMLIKSNGGSGFVENVLLENFIGHGNAYSLD
IDSYWSSMSAVEGDGVQLSNITIKNWKGTEADGAERGPVKVLCADGAPCYDITIEDFAMW
TEEGDTQWYSCESAYGTGFCLEDSSNTVSYAVTTTTVSSAPSGYSAASMADDLTAAFGST
VSIPIPTIPTSFYPGATPYSALMADSASSSTSAKAHPAVGTSSSVATASASVYVAAASAP
AVTSAVAPVAPVAVSSAAESAPSAAGQAQKGQQGQQGQKGQQGFSSGAHTPEPPFGSEEE
DCQE

Enzyme Prediction     

EC	3.2.1.171:11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH28	62	374	6.6e-55	0.9692307692307692

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395231	Glyco_hydro_28	1.74e-20	148	372	85	313	Glycosyl hydrolases family 28. Glycosyl hydrolase family 28 includes polygalacturonase EC:3.2.1.15 as well as rhamnogalacturonase A(RGase A), EC:3.2.1.-. These enzymes are important in cell wall metabolism.
215540	PLN03010	4.67e-19	42	376	48	391	polygalacturonase
177865	PLN02218	4.68e-16	33	355	60	404	polygalacturonase ADPG
215120	PLN02188	1.27e-15	5	374	3	390	polygalacturonase/glycoside hydrolase family protein
215426	PLN02793	2.81e-15	148	408	177	442	Probable polygalacturonase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11707.1|GH28	4.86e-299	4	486	5	490
BCR99404.1|GH28	4.86e-299	4	486	5	490
CAK48512.1|GH28	2.38e-296	4	448	5	449
CAA63912.1|GH28|3.2.1.171	9.68e-296	4	448	5	449
BAE66335.1|GH28	2.37e-259	5	448	6	451

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1RMG_A	7.70e-227	21	442	1	420	Rhamnogalacturonase A From Aspergillus Aculeatus [Aspergillus aculeatus]
4C2L_A	7.35e-17	51	367	26	368	Crystal structure of endo-xylogalacturonan hydrolase from Aspergillus tubingensis [Aspergillus tubingensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2R3G4|RHGB_ASPNC	4.24e-297	4	448	5	449	Probable rhamnogalacturonase B OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=rhgB PE=3 SV=1
sp|P87161|RHGB_ASPNG	1.72e-296	4	448	5	449	Rhamnogalacturonase B OS=Aspergillus niger OX=5061 GN=rhgB PE=1 SV=1
sp|Q0CFC7|RHGB_ASPTN	1.32e-264	2	465	3	464	Probable rhamnogalacturonase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=rhgB PE=3 SV=1
sp|A1DED1|RHGB_NEOFI	3.34e-260	8	455	9	456	Probable rhamnogalacturonase B OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=rhgB PE=3 SV=1
sp|Q2TWN8|RHGB_ASPOR	4.22e-260	5	448	6	451	Probable rhamnogalacturonase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=rhgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000210	0.999780	CS pos: 20-21. Pr: 0.9429

TMHMM  Annotations     

There is no transmembrane helices in PWY79298.1.