CAZyme Information: PWY79187.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY79187.1
• CAZy Family: GH2
• CAZyme Description: concanavalin A-like lectin/glucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
248	MSFL01000016|CGC3	26850.50	3.4258

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000016:234045-234849(+)

Full Sequence      

MNRYLSIPLCLASAVPALAALGARDAIASICTQNNIITTSDFILYNNLWGEDYATSGSEC
TYLDYDSGNSISWQTSWTWAGGADYVKSYPNAVLNVGAKQLSTITSIPSTWGWSYTGTDL
VADVSYDAFFSSSDSTTAAHDYEVMIWLAAYGGIAPIGNEDGPIASATIAGYTWDLYEGP
NDWTVYSFVATETITDFDGDIMEFFTYLIDNEGVPDTYYLQTLGAGTEPKTGSDAWFTVA
PYTISINA

Enzyme Prediction     

EC	3.2.1.4:15	3.2.1.151:9

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH12	99	246	9.5e-42	0.9807692307692307

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396303	Glyco_hydro_12	2.18e-48	46	247	7	207	Glycosyl hydrolase family 12.
235746	PRK06215	6.20e-16	5	191	15	182	hypothetical protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAG17892.1|GH12	1.73e-162	1	247	1	247
CAK38314.1|GH12	1.73e-162	1	247	1	247
BCS12351.1|GH12	3.48e-162	1	247	1	247
BCS00584.1|GH12	3.48e-162	1	247	1	247
CAK36874.1|GH12	8.18e-87	13	246	7	240

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VLB_B	1.91e-79	28	246	5	221	Crystal structure of xeg-edgp [Aspergillus aculeatus],3VLB_D Crystal structure of xeg-edgp [Aspergillus aculeatus]
3VL8_A	2.40e-79	28	246	12	228	Crystal structure of XEG [Aspergillus aculeatus],3VL9_A Crystal structure of xeg-xyloglucan [Aspergillus aculeatus],3VL9_B Crystal structure of xeg-xyloglucan [Aspergillus aculeatus]
4NPR_A	3.05e-73	31	246	28	242	Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus],4NPR_B Crystal Structure of the Family 12 Xyloglucanase from Aspergillus niveus [Aspergillus niveus]
7P1Z_A	6.49e-60	29	247	8	226	Chain A, Glycoside hydrolase [Aspergillus cervinus],7P1Z_B Chain B, Glycoside hydrolase [Aspergillus cervinus],7P1Z_C Chain C, Glycoside hydrolase [Aspergillus cervinus]
6K9D_A	2.26e-59	29	247	2	218	Chain A, GH12 beta-1, 4-endoglucanase [Aspergillus fischeri]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A2Q877|XGEA_ASPNC	1.45e-87	13	246	7	240	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=xgeA PE=3 SV=1
sp|A1XP58|XGEA_ASPNG	8.34e-87	13	246	7	240	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus niger OX=5061 GN=xgeA PE=1 SV=1
sp|O94218|XGEA_ASPAC	1.65e-78	28	246	21	237	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus aculeatus OX=5053 GN=xgeA PE=1 SV=1
sp|Q5BG78|XGEA_EMENI	1.39e-77	28	247	21	239	Xyloglucan-specific endo-beta-1,4-glucanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=xgeA PE=1 SV=1
sp|B8N3L3|XGEA_ASPFN	8.20e-77	8	246	6	239	Probable xyloglucan-specific endo-beta-1,4-glucanase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=xgeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000280	0.999673	CS pos: 19-20. Pr: 0.8414

TMHMM  Annotations     

There is no transmembrane helices in PWY79187.1.