CAZyme Information: PWY78876.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY78876.1
• CAZy Family: GH76
• CAZyme Description: DUF821 domain protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
442	MSFU01000006|CGC1	50558.36	6.1020

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000006:778016-779415(+)

Full Sequence      

MQLLQNQLTSFRFIATGAVLSLIITTFLIFGTQYSNDVAKYALKTSLKSTPQTCLHTSLP
EAGNATAWEFMVERDGDNHGLSDEQCRLAFPKLFVELDKSALLREGHRITFKEVDSLQVE
DGMVRGIIHHGELYVVDFGAMLATFTRGKATLHALHRALASFPDRSSLPDIEFVLTTEDY
SIQEGPVWSYSKRDEQENVWLMPDFGYWSWPEVKIGPYKDLRRRIAAVDDGEVAMDGKFI
PGLPFQNKKKQLAWRGSVATNPEIRGKLLKAAQGRSWASIRVIDWDDENDVRFNLLPMED
YCQYMFLAHAEGRSFSGRGKYLLNCRSVMVSHKLVWREAHHAALIASGPEANYVEVERDF
SDLDQKMEFLIDHPETAQRIAENSVKTFRDRYLTPAAESCYWRQLIRQYAASCEFEPVLY
TQDNGRREPRGVPFESWVLTGF

Enzyme Prediction     

No EC number prediction in PWY78876.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	168	411	1.3e-29	0.976

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
310354	Glyco_transf_90	5.77e-27	125	417	40	327	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.
214773	CAP10	2.02e-21	168	410	2	250	Putative lipopolysaccharide-modifying enzyme.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS13796.1|GT0	0.0	1	442	1	442
BCS02108.1|GT0	0.0	1	442	1	442
UDD61446.1|GT0	2.37e-247	5	439	5	436
QMW41857.1|GT0	5.62e-242	5	439	5	458
QMW29784.1|GT0	1.61e-241	5	439	5	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.86e-11	168	410	94	339	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q16QY8|RUMI_AEDAE	1.55e-13	163	416	133	391	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	1.18e-12	163	416	132	392	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.53e-10	168	410	122	367	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|G3V9D0|PGLT1_RAT	1.97e-09	168	410	122	367	Protein O-glucosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Poglut1 PE=3 SV=1
sp|Q5E9Q1|PGLT1_BOVIN	3.48e-09	168	410	122	367	Protein O-glucosyltransferase 1 OS=Bos taurus OX=9913 GN=POGLUT1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000026	0.000003

TMHMM  Annotations     

Start	End
13	35