CAZyme Information: PWY78631.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY78631.1
• CAZy Family: GH72|CBM43
• CAZyme Description: MIPC synthase subunit

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
359	MSFU01000006|CGC8	42269.61	8.7893

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000006:102252-103451(-)

Full Sequence      

MRRGLLIFLIANLVIVTFLVRSVFTLLSLLVEDASADAIHRAELPSPNSSLIEQRPQIIP
KIIHQTYKNETIPEVWREAQQSCIDLHPDYEYILWTNEKSREFIANEYPWFLETFDGYKY
PIQRADSIRYFVLAHYGGTYIDLDDGCNRRLDPLLAYPAWVRRTVPTGISNDAMGSVPQH
PFFLRTIELLQSYDRHWLLPYITVMYSTGPLFLSVIWKEYMQTNPSESGRVRILMRDEYN
RYSWSFFTHHVGNSWHGKDARLIFWMGQHWVFLTVCGFFLAAVVGFALWWLYARIMLLGS
KYRYRYSKIPSFVSSSRLSSPTRMGRRMMPTLLRRVSFKEDEEAAGVTETSYELYSRRD

Enzyme Prediction     

EC	2.4.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	75	155	1.1e-23	0.9444444444444444

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	1.24e-77	59	286	82	311	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.28e-27	73	157	1	89	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14035.1|GT32	4.76e-268	1	359	1	359
BCS02358.1|GT32	4.76e-268	1	359	1	359
CAK42232.1|GT32	1.94e-267	1	359	1	359
QMW44769.1|GT32	9.42e-236	1	359	1	358
BAE61832.1|GT32	9.42e-236	1	359	1	358

PDB Hits     

PWY78631.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P33300|SUR1_YEAST	6.28e-106	1	278	1	274	Mannosyl phosphorylinositol ceramide synthase SUR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SUR1 PE=1 SV=1
sp|P38287|CSH1_YEAST	1.04e-105	1	278	1	282	Mannosyl phosphorylinositol ceramide synthase CSH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CSH1 PE=1 SV=1
sp|Q9UT67|IMT2_SCHPO	6.75e-91	37	286	56	312	Inositol phosphoceramide mannosyltransferase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC4F11.04c PE=3 SV=1
sp|Q10323|IMT3_SCHPO	1.25e-85	48	278	46	277	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1
sp|O14084|IMT1_SCHPO	2.83e-55	59	296	64	298	Inositol phosphoceramide mannosyltransferase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=imt1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.505952	0.494037

TMHMM  Annotations     

Start	End
5	27
270	292