CAZyme Information: PWY78376.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY78376.1
• CAZy Family: GH18
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MSFL01000017|CGC2	67105.24	6.3421

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000017:609183-610943(+)

Full Sequence      

MQVTPEYCGLEDYGLVGDMHTCALVSKNGSVDSMCWPVFDSPSIFCRILDKQKGGHFSIT
PHNNIKSPLSKQRYRPYTNMLETRWIHEAGVVNILDYFPVEKAKPLGVESRLPEWCRCKQ
KKHPDHHRECHSGLVRKAECVRGQMDVDIELFPAFNYARDSHTACRLNRTVGDGYQTFQF
KSESQTLQLSILEDQGDLDQPGTELRAKFELCESSGHLGPGLVGKVTLNEGQSITMLLHD
QENIASDAQVLAPYLQQIERISGDFWTDWTSQCTFRGHYREQVERSLLVLKLLTYKPTGA
IVAAPTFSLPEHIGGSRNWDYRYSWVRDAAFTIYVFLKNGYPEEAESYVNFIFERIFPPL
NQIPKTGDPFLPIMVTIHGERDIPEIELDHLEGYRGSRPVRIGNGAATHTQLDIYGELMD
SIYLYNKHAAAISYEQWRAIRRMMDFVIQVRHHKDQSIWEVRGPPQNFVYSKIMLWVALD
RGVRLAEKRSNLPCPSRETWVRERDDLYDEIMEHGYNAEKGFFCMSYENKDAFDAAVLIA
PLVFFIAPNDPRLLSTIQKIMEPPGKGGLNVANMVSRYDTSKVDDG

Enzyme Prediction     

No EC number prediction in PWY78376.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	280	584	3.3e-58	0.7728531855955678

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225922	SGA1	3.88e-97	11	562	17	509	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].
395586	Glyco_hydro_15	3.29e-59	277	586	1	301	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
273702	oligosac_amyl	1.63e-06	285	569	260	518	oligosaccharide amylase. The name of this type of amylase is based on the characterization of an glucoamylase family enzyme from Thermoactinomyces vulgaris. The T. vulgaris enzyme was expressed in E. coli and, like other glucoamylases, it releases beta-D-glucose from starch. However, unlike previously characterized glucoamylases, this T. vulgaris amylase hydrolyzes maltooligosaccharides (maltotetraose, maltose) more efficiently than starch (1), indicating this enzyme belongs to a class of glucoamylase-type enzymes with oligosaccharide-metabolizing activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS16993.1|GH15	0.0	1	586	1	585
BCS05439.1|GH15	0.0	1	586	1	585
CAK41144.1|GH15	0.0	1	586	1	564
QMW26935.1|GH15	3.66e-287	5	586	6	588
QMW39015.1|GH15	3.66e-287	5	586	6	588

PDB Hits     

PWY78376.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q10211|YAY3_SCHPO	2.96e-164	10	586	19	558	Uncharacterized protein C4H3.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4H3.03c PE=4 SV=1
sp|A0R0W9|TREH_MYCS2	1.49e-83	10	586	42	572	Trehalase OS=Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) OX=246196 GN=MSMEG_4535 PE=1 SV=1
sp|P71741|TREH_MYCTU	3.80e-83	10	586	54	584	Trehalase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2402 PE=1 SV=2
sp|Q978S7|TREH_THEVO	3.91e-76	3	560	22	515	Trehalase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) OX=273116 GN=TVG1381191 PE=1 SV=1
sp|Q9HLE2|TREH_THEAC	8.06e-76	24	560	2	473	Trehalase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) OX=273075 GN=Ta0286 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000064	0.000001

TMHMM  Annotations     

There is no transmembrane helices in PWY78376.1.