CAZyme Information: PWY78214.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY78214.1
• CAZy Family: GH18
• CAZyme Description: Glyco_hydro_cc domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317VUY5]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		30614.81	4.4440

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000017:100528-101397(+)

Full Sequence      

MVSIKSLLTASALASAVLAIPHNANPHTHNHRSSRIPSKRTSSSSSSSSGGKRGAAYNTA
TSVKTLSSGSSGNGTISWAYDWNMYDDGTLPSGIEYIPMLWGSKMFGTWFTAIEAALSSG
SNYILGFNEPDASSQADMSPSTAASAYKNYITPYSGKAKLVTPAVTSSTTSGEGLSWMKS
FLSECSSCDLSVLAVHWYGDSASEFKEFVTEAIQVASDYDLEETWITEFALTSDMSAGGD
TSAGAKFLDEVIPWLDAESGVGRYAYFMCADGYLLDGESLSDSGKVYVA

Enzyme Prediction     

No EC number prediction in PWY78214.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH128	71	287	4.1e-66	0.9776785714285714

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
371727	Glyco_hydro_cc	9.91e-83	56	287	1	235	Glycosyl hydrolase catalytic core. This family is probably a glycosyl hydrolase, and is conserved in fungi and some Proteobacteria. The pombe member is annotated as being from IPR013781.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ACK11743.1|GH128	2.34e-156	1	289	1	283
CAK45900.1|GH128	1.92e-155	1	289	1	283
BCS15933.1|GH128	1.01e-150	1	289	1	283
BCS04345.1|GH128	1.01e-150	1	289	1	283
BAE57006.1|GH128	2.55e-116	1	287	1	271

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6UB0_A	2.53e-58	51	287	3	227	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -2 and -1 subsites [Blastomyces gilchristii SLH14081]
6UAY_A	6.41e-58	51	287	34	258	Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAY_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) [Blastomyces gilchristii],6UAZ_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UAZ_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with glucose [Blastomyces gilchristii],6UB1_A Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_B Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_C Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii],6UB1_D Crystal structure of a GH128 (subgroup III) curdlan-specific exo-beta-1,3-glucanase from Blastomyces gilchristii (BgGH128_III) in complex with laminaribiose at -3 and -2 subsites [Blastomyces gilchristii]
6UB2_A	9.07e-20	51	286	24	246	Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_C Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB2_D Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) [Lentinula edodes],6UB3_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB3_B Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) with laminaribiose at the surface-binding site [Lentinula edodes],6UB4_A Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB4_B Crystal structure (C2 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB5_A Crystal structure (P21 form) of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritriose [Lentinula edodes],6UB6_A Crystal structure of a GH128 (subgroup IV) endo-beta-1,3-glucanase from Lentinula edodes (LeGH128_IV) in complex with laminaritetraose [Lentinula edodes]
6UAX_A	9.35e-19	52	286	95	335	Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56],6UAX_B Crystal structure of a GH128 (subgroup II) endo-beta-1,3-glucanase from Sorangium cellulosum (ScGH128_II) [Sorangium cellulosum So ce56]
6UAQ_A	1.18e-12	78	289	47	261	Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) [Amycolatopsis mediterranei],6UAR_A Crystal structure of a GH128 (subgroup I) endo-beta-1,3-glucanase from Amycolatopsis mediterranei (AmGH128_I) in complex with laminaritriose [Amycolatopsis mediterranei]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q09788|ASL1_SCHPO	5.22e-19	51	289	295	530	Alkali-sensitive linkage protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=asl1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.861857	0.138154

TMHMM  Annotations     

There is no transmembrane helices in PWY78214.1.