CAZyme Information: PWY77750.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY77750.1
• CAZy Family: GH7
• CAZyme Description: BNR/Asp-box repeat protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
376		41379.26	6.3949

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000007:537894-539024(+)

Full Sequence      

MPGHFGQKILNTLGIDHHGHHGHGQGQPYQQPPPPGDNRLAGNRVIHNDERLLSPHPAGT
YPRLARLSDGRILASFTRFVGGGERVLMVSISEDNGQTFTDHGEITRGKGDVDNVYLLEI
GPGTVLAAFRNHDIGPGGPTHFRITVCRSTDAGRSWSFASQAAEKPAPLGIWEPFMRLGR
RPGEIQLTYSQEFAHNNQCTMLVRSYDGGSSWSAPQCLHGAEDQRRDGMNGIARTWDQAR
NCEALVMVFETTTYGTFDVEALVSYDDGETWGGRQQVYVPPQGHNAGAPQIASLGDGSLA
VIFMCDEDFDEVNWTRNACVKVVFGSMPHEGRIMWTRPTTVCRDSSHWPGIFTLDDRRLL
ALYECGGPKAKTIALE

Enzyme Prediction     

No EC number prediction in PWY77750.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	58	321	2.4e-68	0.9055374592833876

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	4.15e-11	68	310	86	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.10e-10	62	370	17	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	4.96e-05	54	157	194	294	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	4.39e-291	1	376	1	376
BCS11580.1|GH93	4.39e-291	1	376	1	376
BCS24955.1|GH93	9.31e-182	1	375	1	364
QMW42642.1|GH93	2.18e-181	1	375	1	378
QMW30589.1|GH93	2.18e-181	1	375	1	378

PDB Hits     

PWY77750.1 has no PDB hit.

Swiss-Prot Hits     

PWY77750.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000031	0.000018

TMHMM  Annotations     

There is no transmembrane helices in PWY77750.1.