CAZyme Information: PWY77681.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY77681.1
• CAZy Family: GH6
• CAZyme Description: mannan endo-1,6-alpha-mannosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MSFU01000007|CGC10	44652.40	3.9705

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000007:348461-349823(-)

Full Sequence      

MTWYHGNETGQIPGAFPSKWWEGSALFTSLLLYWYYTGDSTYNDEVRQGMQWQAGDCDYM
PANYSSYLGNDDQMFWGLAAITAAEIEFADSSSGYSWLALAQGVYNTQVDRWDDSTCGGG
LRWQIYPYEAGYAMKNSISNGGLFQLAARLARYTSNDTYADWAEKIFDWCASTPLLNNQT
WNVADSTDVDNDCSSQGNNQWSYNYGVFLTGAAYMYNYTGKAKWKNAAEGLLNVTLDTFF
PAKYGGNIMSEILCEPTEVCNDNEILFKGLVTGWLGLVALIMPSTSSLILPKLQGSAEAA
AASCNGMGNNTCGVRWYPKKWDGWNGMEEEIAVTNVLASALYNTKQTAPVTSSTGGNSTS
DPNAGTGDDTGDSDSTESKITTGDKAGASILTIAFVGMWGGMIAWMVIGG

Enzyme Prediction     

No EC number prediction in PWY77681.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	2	350	5e-96	0.9106145251396648

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.75e-168	1	333	14	347	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
227170	COG4833	9.02e-06	97	318	97	317	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS11652.1|GH76	8.22e-295	1	410	48	457
BCR99351.1|GH76	8.22e-295	1	410	48	457
CAK46589.1|GH76	5.07e-289	1	410	48	457
BAE65580.1|GH76	2.79e-228	1	409	47	455
UDD65266.1|GH76	2.28e-227	1	409	47	455

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	1.72e-90	1	365	48	425	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5AD78|DCW1_CANAL	1.31e-100	1	408	41	452	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DCW1 PE=1 SV=1
sp|P36091|DCW1_YEAST	3.37e-100	1	392	44	433	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|O74556|YCZ2_SCHPO	2.44e-98	1	365	42	407	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|Q6FLP9|DCW1_CANGA	2.76e-95	1	398	41	435	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	3.47e-95	16	395	52	429	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.998853	0.001179

TMHMM  Annotations     

Start	End
20	37
386	408