CAZyme Information: PWY77544.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY77544.1
• CAZy Family: GH17
• CAZyme Description: GPI mannosyltransferase 2

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MSFL01000018|CGC1	51398.63	8.5853

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000018:623305-624797(-)

Full Sequence      

MSWLPHRIVHRPYCSLLGTFVLWKAFLLLLAVLAPGPGYDTSTTLAQWSSSGPDGPIPAL
LRRISIKLTRWDAIYFTEAARRGYLFEQEWAFSYAVNRLINFVTNGVQHICAFDYEFGES
LVSIAVSHGAHAMSVLFLHRLACTILPGMQGRRLAFIAACLHIISPAGLFMSAPNAESIY
SLLSFTGALLFAQSFGSSGGSTGTQDGLLVLAGIVCGLATSVRGNGLLNGLLFLEEAFGI
SYSLTQCFTFDKFRRLFAVSLGGICTGLGFVLPQYLAYREFCVDYTSTHVGAPRVWCNRA
LPSIYSFVQDHYWNNGFLRYWTLSNVPLFALASPMLVILTYSAFWSLDAESDLNRTSMAL
KEQVESRPQLAGRLLRSLAASQIILTVQVFLCNHVQIITRLSSGYPVWYIWVAALLVRKY
PVGTSRDEQTRDKGKDWYANAIVQYMVIYGIVQGALFASFLPPA

Enzyme Prediction     

No EC number prediction in PWY77544.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT76	19	464	3.4e-112	0.9901719901719902

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
282094	Mannosyl_trans2	3.85e-35	39	464	29	439	Mannosyltransferase (PIG-V). This is a family of eukaryotic ER membrane proteins that are involved in the synthesis of glycosylphosphatidylinositol (GPI), a glycolipid that anchors many proteins to the eukaryotic cell surface. Proteins in this family are involved in transferring the second mannose in the biosynthetic pathway of GPI.
227829	COG5542	2.88e-13	70	464	76	408	Mannosyltransferase related to Gpi18 [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR97098.1|GT76	1.69e-200	1	464	1	464
BCS09572.1|GT76	1.69e-200	1	464	1	464
QMW44188.1|GT76	3.76e-167	1	464	1	472
QRD83592.1|GT76	2.47e-165	1	464	1	472
QMW32162.1|GT76	2.47e-165	1	464	1	472

PDB Hits     

PWY77544.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q2UJS7|GPI18_ASPOR	1.39e-98	10	464	16	434	GPI mannosyltransferase 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi18 PE=3 SV=1
sp|Q2GSI6|GPI18_CHAGB	5.93e-98	6	464	11	471	GPI mannosyltransferase 2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) OX=306901 GN=GPI18 PE=3 SV=1
sp|Q4I0K3|GPI18_GIBZE	7.03e-96	11	464	9	423	GPI mannosyltransferase 2 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI18 PE=3 SV=1
sp|Q4WQ21|GPI18_ASPFU	5.22e-91	11	464	28	441	GPI mannosyltransferase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi18 PE=3 SV=1
sp|Q6C216|GPI18_YARLI	6.35e-53	11	464	2	357	GPI mannosyltransferase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) OX=284591 GN=GPI18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.991357	0.008653

TMHMM  Annotations     

Start	End
13	35
120	142
154	173
178	200
207	224
256	278
323	345
395	417
438	460