CAZyme Information: PWY77019.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY77019.1
• CAZy Family: GH16
• CAZyme Description: GPI mannosyltransferase 1 [Source:UniProtKB/TrEMBL;Acc:A0A317VTV9]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
487		53386.20	9.9532

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000019:224278-226005(+)

Full Sequence      

MASSRSVYAPTDGYTYPLSLTLYPRPRAASPTPPTHVTPNQTPWPPHPSPPHPPNPSKSK
STSTSTSTFFTSPTHIYTTALLLRLTLLLYGIYQDTTSALKYTDIDYLVFTDASHYTRQG
LSPYARDTYRYTPLLAWLLLPTSLTIPSSPLLTTLLFSSGKILFLLSDLLAGWLITKSLV
QAYGMDAPRARKYAAGWLLNPMVANISTRGSSEGVLCVLVVGMVWAALGRRVWLAGAVLG
VSVHLKIYPFVYGVAIVWWLGGSGSRTPILSFITKDRIILTLSSLFTFAALNALMYALYS
TPFLQHTFLHHLTRIDHRHNFSPYSTLLYLSAAGDSSASSSSSSSFAFESLAFIPQLLLS
VVVLPLALAKKSLPGAMLAQTFAFVAFNKVVTSQYFLWYLIFLPFYLPLPTCSLRQKPKT
TGAAVAVLWVLGQALWLHQAYNLEFLGLSTFVPGLFLSSLGFFAVNVWILGVVVGDLVAL
PSSSSSW

Enzyme Prediction     

EC	2.4.1.-:14

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT50	206	473	3.7e-88	0.9923664122137404

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
178434	PLN02841	6.47e-69	90	474	25	415	GPI mannosyltransferase
252941	Mannosyl_trans	9.44e-63	206	471	1	256	Mannosyltransferase (PIG-M). PIG-M has a DXD motif. The DXD motif is found in many glycosyltransferases that utilize nucleotide sugars. It is thought that the motif is involved in the binding of a manganese ion that is required for association of the enzymes with nucleotide sugar substrates.
399599	PIG-U	2.51e-05	118	313	45	243	GPI transamidase subunit PIG-U. Many eukaryotic proteins are anchored to the cell surface via glycosylphosphatidylinositol (GPI), which is posttranslationally attached to the carboxyl-terminus by GPI transamidase. The mammalian GPI transamidase is a complex of at least four subunits, GPI8, GAA1, PIG-S, and PIG-T. PIG-U is thought to represent a fifth subunit in this complex and may be involved in the recognition of either the GPI attachment signal or the lipid portion of GPI.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS05340.1|GT50	3.22e-189	69	479	11	421
BCS16894.1|GT50	3.22e-189	69	479	11	421
EAA63338.1|GT50	1.58e-172	70	486	5	437
UDD65877.1|GT50	4.82e-172	70	477	5	410
BAE66105.1|GT50	1.16e-171	70	477	30	435

PDB Hits     

PWY77019.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5B7W0|GPI14_EMENI	2.81e-173	70	486	5	437	GPI mannosyltransferase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=gpi14 PE=3 SV=1
sp|Q2TXB8|GPI14_ASPOR	8.57e-173	70	477	5	410	GPI mannosyltransferase 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpi14 PE=3 SV=2
sp|Q4WAH2|GPI14_ASPFU	8.64e-168	69	477	4	421	GPI mannosyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=gpi14 PE=3 SV=1
sp|Q7S4Z3|GPI14_NEUCR	3.64e-149	70	476	23	484	GPI mannosyltransferase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=gim-1 PE=3 SV=1
sp|Q4I073|GPI14_GIBZE	1.71e-141	70	476	7	407	GPI mannosyltransferase 1 OS=Gibberella zeae (strain ATCC MYA-4620 / CBS 123657 / FGSC 9075 / NRRL 31084 / PH-1) OX=229533 GN=GPI14 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000005	0.000037

TMHMM  Annotations     

Start	End
135	157
162	184
214	233
248	265
278	300
346	368
381	403
423	445
452	474