CAZyme Information: PWY76311.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY76311.1
• CAZy Family: GH16
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1116	MSFL01000020|CGC2	121007.31	5.5121

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000020:501755-505461(+)

Full Sequence      

MRWYQLLSSVLALLPLSVAQDCWRNTTCSGPTESAFSGPWEENIFAPSSRSVSPEKLFLI
TQPDKTADYAPFTLQGNGSLVVYDFGKEVGGIVRVNYSSTGSGALGVAFTEAKDYIGEWS
DSSNGGFKGPDGALYGNFTEAGSHYYVMPDKVLRGGFRYLSLFLITSGNVSVQIEDVSLE
IGFQPTWSNLKAYQGYFHSDDDLLNKIWYSGAYTLQTNEVPTDTGRQIPALAVGWANNAT
LGPGDTIIVDGAKRDRAVWPGDMGIAVPSAFVSLGYLESVKNALQVMYDTQDNSTGAFDE
SGPPLSQKDSDTYHMWTMVGTYNYMLYTNDSDFLEQNWEGYQKAMTYIYDKTGSKLATWA
EDSTGLSATWTDRAEKLRQAINEYCWDEGYGAFKDNATETTLHPQDANSMALLFGVVDED
RAASISERLTDNWTPIGAVAPELPENISPFISSFEIQGHLTVGQPARALELIRRSWGWYY
NNPNGTHSTVIEGYLQNGSFGYRGDRGYYWDTAYVSHSHGWSSGPTSALTNFIVGLTVTS
PLGATWSLAPQFVDLKSAEAGFTTSLGKFQAAWSKGADNYTLDFTVPKGTNGNLTLPFIS
TAKPSIQIDGTEITQGVGYANETATVAGSPYHVRRSPLVTKTNVWLHPILSKSSTSTLLH
TSHHRTKPTMPPMPPLQAARASPWLNCPRRMRTTSTPQRLFTTTRLLRSSTTTTTTNPLR
TPPRAPRHRDAEIAKSKRSIFISASGIAACAVAMYGVIKLDLFAADQAQSSSSTSTSTTT
DATDATPTSTNQTALDGPSGFPSSPSLIRISGQEPGAEQVPTGTSSVPYFPSTIRIPKEL
DNLTSGDDIRSETEETDGEEYQLLGLGIRTVSFLGIQVYVVGMYVAKADIAELQRRLVRV
GVEAQGILQAQAESQSKTGSGVAVPETVKAGGDGISATSLVSTERAALKDLLDSDRGDAI
WDAIIKPDGLRTAFRVVPTRNTDFLHLRDGWVRGVTARAQKYNPSSGGQFADEGFGAAMN
EFKGLFGGGQRKNVAKGQTVVLVRGLAGQLDALVRVAPDLPGRYMGRVVDERVSRLVWLN
YLAGKGVSSEGARRSVVEGVMEVVERPVGTVVQKVF

Enzyme Prediction     

EC	3.2.1.174:2	3.2.1.174:2

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	352	596	1.5e-43	0.44642857142857145
GH78	80	351	3.4e-40	0.4642857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
406443	Chalcone_2	3.87e-76	859	1095	1	201	Chalcone isomerase like.
407469	Bac_rhamnosid6H	2.42e-06	195	431	4	253	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	4.63e-06	545	597	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
225922	SGA1	0.001	71	426	114	502	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43282.1|GH78	0.0	1	1111	1	1131
UCK57529.1|GH78	0.0	6	629	12	676
QRD88907.1|GH78	0.0	6	629	12	676
QMW37218.1|GH78	0.0	6	629	9	664
QMW25160.1|GH78	0.0	6	629	9	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CIH_A	1.71e-07	81	617	194	714	Crystal structure of a putative alpha-rhamnosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q6BN19|AIM18_DEBHA	1.15e-12	860	1099	98	293	Altered inheritance of mitochondria protein 18, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / BCRC 21394 / JCM 1990 / NBRC 0083 / IGC 2968) OX=284592 GN=AIM18 PE=3 SV=1
sp|Q75DU9|AIM18_ASHGO	1.83e-10	861	1104	100	304	Altered inheritance of mitochondria protein 18, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=AIM18 PE=3 SV=1
sp|C5DFS5|AIM18_LACTC	6.06e-09	832	1104	74	305	Altered inheritance of mitochondria protein 18, mitochondrial OS=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) OX=559295 GN=AIM18 PE=3 SV=1
sp|Q10102|YAQ1_SCHPO	1.22e-08	859	1096	65	245	Uncharacterized protein C18G6.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC18G6.01c PE=4 SV=1
sp|Q6CWH8|AIM18_KLULA	4.96e-08	860	1097	109	308	Altered inheritance of mitochondria protein 18, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) OX=284590 GN=AIM18 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000262	0.999696	CS pos: 19-20. Pr: 0.9777

TMHMM  Annotations     

There is no transmembrane helices in PWY76311.1.