CAZyme Information: PWY76235.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY76235.1
• CAZy Family: GH13|GH13
• CAZyme Description: putative arabinogalactan endo-1,4-beta-galactosidase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
351	MSFL01000020|CGC1	38389.54	3.7051

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000020:272082-273200(+)

Full Sequence      

MKFLPLIFSSLPLLASAGLTYSGADISSLLIEEESGISYKNLDGETQALETILANNGVNA
VRQRVWVNPSDGSYDLDYNLKLAKRVKAAGMSIYLDLHLSDTWASPSAQATPSGWSTTDI
DTLTWQLYNYTLSVCNTFAENDLDVEIVSIGNEIRAGLLWPLGETSNYDNIAKLLHSGAW
GVKDSDQTTTPKIMIHLDNGWDWDEQEYFYNTVLATGSFLSTDFDIIGVSYYPFYSSDAT
LSALTTSLANLQSTYSKPVAVVETDWPISCPDPAYAFPSDLSSIPFSAAGQEEFMEKLAA
VVEDTTDGEGIYYWEPAWVDNADLGSSCSSVIMVDSSNDEVLESVTVFADI

Enzyme Prediction     

EC	3.2.1.89:16

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	22	348	1.2e-100	0.9941520467836257

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
311610	Glyco_hydro_53	2.22e-141	21	348	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
226385	GanB	1.82e-68	23	319	42	345	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB40555.1|GH53|3.2.1.89	2.29e-216	5	351	4	350
BCR97719.1|GH53	1.79e-214	1	351	4	354
CAC83735.1|GH53|3.2.1.89	3.11e-214	5	351	4	350
BCS10178.1|GH53	7.27e-214	1	351	4	354
CAK43317.1|GH53|3.2.1.89	1.26e-213	6	351	5	350

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1FHL_A	2.64e-196	19	351	2	334	Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 293k [Aspergillus aculeatus],1FOB_A Crystal Structure Of Beta-1,4-galactanase From Aspergillus Aculeatus At 100k [Aspergillus aculeatus],6Q3R_A ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus],6Q3R_B ASPERGILLUS ACULEATUS GALACTANASE [Aspergillus aculeatus]
4BF7_A	8.03e-186	10	351	10	350	Emericilla nidulans endo-beta-1,4-galactanase [Aspergillus nidulans]
1HJS_A	1.71e-142	19	348	2	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	9.26e-140	19	348	2	329	Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]
1R8L_A	3.74e-40	23	319	27	325	The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9Y7F8|GANA_ASPTU	4.07e-217	5	351	4	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus tubingensis OX=5068 GN=galA PE=2 SV=1
sp|Q8X168|GANA_ASPNG	5.52e-215	5	351	4	350	Arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger OX=5061 GN=galA PE=1 SV=1
sp|A2RB93|GANA_ASPNC	2.25e-214	6	351	5	350	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=galA PE=3 SV=1
sp|P48842|GANA_ASPAC	1.33e-199	3	351	2	350	Arabinogalactan endo-beta-1,4-galactanase OS=Aspergillus aculeatus OX=5053 GN=gal1 PE=1 SV=1
sp|Q5B153|GANA_EMENI	3.84e-185	10	351	10	350	Arabinogalactan endo-beta-1,4-galactanase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=galA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000322	0.999661	CS pos: 17-18. Pr: 0.9693

TMHMM  Annotations     

There is no transmembrane helices in PWY76235.1.