CAZyme Information: PWY75761.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY75761.1
• CAZy Family: GH5
• CAZyme Description: alpha 1,6 mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MSFU01000009|CGC2	41382.31	4.9225

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000009:542187-543308(-)

Full Sequence      

MLPSTLKSSRYGRFVILTIPLLVFSCLLFLTWDPLPGRLRQQSQAPTTSQSDTVTQVPQP
VEPPKEEASRPKPPVSISDPSTSNPIADIAGGDAIFGITDKLWQSAKNPHLSDDQDEWIS
SWLDKNPSFRYELLTDASAATFVRTHYASRPDIIEVFETLPIPILKADLLRYLLVLAEGG
VWSDLDVTCDKPVADWVPTEYKNAKIEMIVGLEFDFEWRGEGTEVASQFCNWVFAAPRSS
RVLQVVVDSVVAQINEIALMNKVQVKDLTLEMLPIDVVNVTGPKIMTIAILDSLKKLLGR
TVDDRDFHGIKKPKLIGDVLVMPGVSFAASQNGYPQDQGDALVTHHYAGSWKQADAEAKE
KKKQKQNGRDEGV

Enzyme Prediction     

No EC number prediction in PWY75761.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT32	117	199	3.4e-20	0.9333333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	3.24e-19	98	215	82	198	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.47e-14	119	201	8	91	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS14453.1|GT32	1.53e-262	1	373	1	373
BCS02801.1|GT32	5.46e-262	1	373	35	407
CAK46331.1|GT32	1.31e-238	1	373	52	421
QKX62870.1|GT32	5.07e-123	1	366	1	378
QQK48128.1|GT32	9.94e-121	75	365	50	353

PDB Hits     

PWY75761.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	2.95e-26	102	352	146	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	8.36e-25	117	352	122	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P47124|HOC1_YEAST	2.21e-23	102	327	134	361	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3
sp|P31755|OCH1_YEAST	9.15e-14	97	252	107	284	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|Q10323|IMT3_SCHPO	8.99e-07	94	191	56	147	Inositol phosphoceramide mannosyltransferase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17G8.11c PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000025	0.000001

TMHMM  Annotations     

Start	End
13	32