CAZyme Information: PWY75564.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY75564.1
• CAZy Family: GH43
• CAZyme Description: FAD/NAD(P)-binding domain-containing protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MSFU01000009|CGC4	56548.99	5.2926

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000009:32821-34383(+)

Full Sequence      

MAYGRPSAVDLDDWGTIAGNIAGNSDWSWAGLAPYYRKSEQLESAGLTGTASELCPVQKE
AHGTQGPIHTSLGPWQAPIETPLLAAMDEVSGLSRPQEPWNGEHLGFHRCLFTIDRSAGL
PHRSYAANGYLWPVLSRPNLHVLTNAAVTRILLDEEQCARGVEFVHEGNKYQVSITREVI
LSAGTFESPKLLELSGIGHPEHLASLGVPCRVPLPGVGTNLQEHPVSAVVYELADEVLSI
DSILRDESLLKQHLRLLQEEQSGALSGPVSLMGFIPYGPQVSAERLNETILNVLQHHSND
ATDDAELVTFEHRRRQRIAAHLLDPRSADIQLVGFPSAFAIDRVYTDFSKLSPGPPPGRN
ACYSLMVSSMYPVSQGSSHAQSRDPEAAPRVDLGFLKNPADVDVLATAVMVADSIFQSPR
MKRQVLARVQPPPEVNLQDLEQAREYVLDRLMSYHHALGTCALGLVVDEELCVKGTRGLR
VVDASIMPAQVSHAVLGTVYAIAEKAVDLIESAYTQSNGV

Enzyme Prediction     

No EC number prediction in PWY75564.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	1	511	3.3e-122	0.8345070422535211

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
235000	PRK02106	1.37e-63	1	510	97	531	choline dehydrogenase; Validated
225186	BetA	4.21e-61	1	510	96	533	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
398739	GMC_oxred_C	6.67e-28	372	506	1	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.84e-20	1	226	36	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	1.07e-14	72	486	177	552	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS02582.1|AA3_2	0.0	1	520	108	623
BCS14253.1|AA3_2	0.0	1	520	108	623
CAK97143.1|AA3_2	7.82e-283	1	519	106	580
UPX44764.1|AA3_2	5.01e-173	1	514	104	612
ATZ47931.1|AA3_2	1.85e-170	1	511	104	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZE2_A	6.63e-38	1	514	93	586	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
4YNT_A	2.93e-36	1	511	95	565	Crystal structure of Aspergillus flavus FAD glucose dehydrogenase [Aspergillus flavus NRRL3357],4YNU_A Crystal structure of Aspergillus flavus FADGDH in complex with D-glucono-1,5-lactone [Aspergillus flavus NRRL3357]
2JBV_A	3.67e-35	10	513	111	529	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	3.67e-35	10	513	111	529	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]
3LJP_A	4.99e-35	10	513	111	529	Chain A, Choline oxidase [Arthrobacter globiformis],3LJP_B Chain B, Choline oxidase [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A161CEV4|CITC_MONRU	6.58e-171	1	511	104	609	Dehydrogenase citC OS=Monascus ruber OX=89489 GN=citC PE=1 SV=1
sp|A0A142PTM2|CITC_MONPU	6.58e-171	1	511	104	609	Dehydrogenase mpl7 OS=Monascus purpureus OX=5098 GN=mpl7 PE=1 SV=1
sp|A0A5C1RDA6|ASC9_DIDFA	8.17e-161	1	510	104	616	Dehydrogenase OS=Didymella fabae OX=372025 GN=orf9 PE=3 SV=1
sp|A0A2H3D1U1|ARMD5_ARMGA	3.12e-53	5	511	140	630	Dehydrogenase ARMGADRAFT_1018426 OS=Armillaria gallica OX=47427 GN=ARMGADRAFT_1018426 PE=1 SV=1
sp|M5EAX2|GMCH_MALS4	2.46e-47	1	510	139	615	GMC oxidoreductase family protein Mala s 12 OS=Malassezia sympodialis (strain ATCC 42132) OX=1230383 GN=MSY001_2108 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000018	0.000031

TMHMM  Annotations     

There is no transmembrane helices in PWY75564.1.