CAZyme Information: PWY75458.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75458.1
• CAZy Family: GH135
• CAZyme Description: acetylxylan esterase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
395		44375.47	5.5331

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000021:294492-296200(-)

Full Sequence      

MRFSHLCLLVWALQASATILQNGQVREDAYPGQAPEILVDDSWRAYGPDAPEISYKGRWD
RQYVSCERLPGIKLGFTGSQLALRFGSQTSEGVLLAYRFGGLDWKFSNVTTNAIYQFAGP
WTAGMNSTREKTFEMRVQLSGVYIASDGELTKALQYNKTVEIIGDSFASGQYATYEGLSA
WAYSFAAGLGDVEYSITAYPGICLTDKSCYSNEARGMTHQWFYAADVGARAEATYGNNPQ
KWNFSAHPPADLVIIDLGTNDQRNNVSGSDFYDSYTALINSVHDTYPQAEIVLMSLWGKF
FRYGDKYIQSPFYAPDLHRVFESFHDQPFVHYFGTKGILQHNDIDPQGHPTDVGHLKIAS
HLMQWTKLKLGWEFGATGAEVQHDTLYWNDQAGYR

Enzyme Prediction     

No EC number prediction in PWY75458.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE2	161	364	6.9e-22	0.9760765550239234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238869	Endoglucanase_E_like	9.82e-41	160	367	2	169	Endoglucanase E-like members of the SGNH hydrolase family; Endoglucanase E catalyzes the endohydrolysis of 1,4-beta-glucosidic linkages in cellulose, lichenin and cereal beta-D-glucans.
404371	Lipase_GDSL_2	6.27e-12	189	355	2	174	GDSL-like Lipase/Acylhydrolase family. This family of presumed lipases and related enzymes are similar to pfam00657.
238141	SGNH_hydrolase	3.74e-11	160	364	1	186	SGNH_hydrolase, or GDSL_hydrolase, is a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the typical Ser-His-Asp(Glu) triad from other serine hydrolases, but may lack the carboxlic acid.
238863	SGNH_hydrolase_peri1	2.25e-04	249	311	56	119	SGNH_peri1; putative periplasmic member of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238872	SGNH_hydrolase_like_2	0.003	231	359	44	185	SGNH_hydrolase subfamily. SGNH hydrolases are a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QMW34907.1|CE0	1.68e-190	1	395	1	399
QMW46983.1|CE0	1.68e-190	1	395	1	399
QRD91240.1|CE0	1.68e-190	1	395	1	399
CAK41944.1|CE0	3.54e-186	1	395	1	376
BCS11519.1|CE0	6.43e-185	69	395	41	369

PDB Hits     

PWY75458.1 has no PDB hit.

Swiss-Prot Hits     

PWY75458.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000219	0.999769	CS pos: 17-18. Pr: 0.9770

TMHMM  Annotations     

There is no transmembrane helices in PWY75458.1.