CAZyme Information: PWY75389.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75389.1
• CAZy Family: GH13
• CAZyme Description: neuraminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
373	MSFL01000021|CGC6	41138.99	6.5797

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000021:116441-117562(-)

Full Sequence      

MPGHFGQKILNSFGMDHHHHHHQGQPYQQPPPPGDNRLAGNRIIHNDERLLSSHPAGTYP
RLARLSDGRILASFTRFYGGGERALLVSISSDNGHTFTDHGEVTRGHGDVDNTFLLEVGP
GVVLAAFRNHDNGPNGPVHFRITVCRSTDSGRTWAFASQAAEKPAPLGIWEPFMRLGRRP
GEIQLTYSQEFAHDNQCTMLVRSFDQGSTWSPPHCLHGAQDPRRDGMNGIARTWDNGREA
LVMVFETTSYGTFDVEALLSYDDGETWGWRHQVYVPPRGHNAGAPQIASLGDGSLAVIFM
TDEDCGEVSWTKNACVKVVFGAPPVEGRVQWTQPTAVCGDMSHWPGIFALDERRLLALYE
CGGPKAKTIALEM

Enzyme Prediction     

No EC number prediction in PWY75389.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH93	56	313	2.3e-68	0.8925081433224755

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
271234	Sialidase_non-viral	1.21e-13	115	306	19	223	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.00e-12	66	304	86	327	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	2.03e-11	60	366	17	329	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.
271234	Sialidase_non-viral	1.43e-06	52	154	194	293	Non-viral sialidases. Sialidases or neuraminidases function to bind and hydrolyze terminal sialic acid residues from various glycoconjugates, they play vital roles in pathogenesis, bacterial nutrition and cellular interactions. They have a six-bladed, beta-propeller fold with the non-viral sialidases containing 2-5 Asp-box motifs (most commonly Ser/Thr-X-Asp-[X]-Gly-X-Thr- Trp/Phe). This CD includes eubacterial and eukaryotic sialidases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR99274.1|GH93	5.88e-229	1	372	1	376
BCS11580.1|GH93	5.88e-229	1	372	1	376
EAA62412.1|GH93	6.91e-179	1	372	1	367
BCS24955.1|GH93	1.30e-178	4	371	3	364
CAP92687.1|GH93	1.88e-175	1	369	1	358

PDB Hits     

PWY75389.1 has no PDB hit.

Swiss-Prot Hits     

PWY75389.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000041	0.000005

TMHMM  Annotations     

There is no transmembrane helices in PWY75389.1.