CAZyme Information: PWY75354.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75354.1
• CAZy Family: GH13
• CAZyme Description: alpha-L-rhamnosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
784		87733.52	7.0332

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000021:9415-11837(+)

Full Sequence      

MEDWSLHPPWVWLPPSHYREEDNQPARFFLFRKTFSWQPDDHDQDDQDDQPVLLHVSADS
RYRLFVNGHRVSFGPCKSPRGQWHYETVDIRPHLRRGRHRNVLSARVLRYSSLVPGSSSI
VSRPRPGFLLVPAVPGRPPVGTDTPWRCCEETTRRIVPRSEWNYLLGPPFLCINERVTED
AALAGWHSPPYDDAAWPAAVPQETAAVQMLPVVSPWRLAPRPIPALPETPGRLDGVIQTH
GAVSADQWTALIRADQPVVVPARARVTVDLAVAHLLTAFDLGVDTSPVPRPRSKADRSDP
RGGRARLYGPRDFYTVAAGQPAHAFEPFWFRCFRYCQLDIVTADAPLTVSGIALRETSYP
LPVTTRLLQATPPDLMRIWAISLRTLQNCRHETYEDCPFYEQNQFAADARLQMRFGYQLS
PDDRLARKTLAEFDASRTPDGLIGAQSPSGFPSRQIPLFSLFWILMLHDHLRYHADAALV
RRYLGTVDGIVQHFEARLDAARGLVGRFEADTWPFVDWVAAWMVPGHIFASCMPPAYHAT
GAATVNSLLYAYALRHAADLCDFVGRRSTADEYRARVATLQAAVNAQCRGEASAFYQDGP
GVAQYSQHTQVFAILTDTVTGDAARRLLRQTLAAPGLARCSYAMQFYVFRAAEHTGLYAE
VFAQLLAPWRAMMAQNLTTWAEDDVNARSDCHGWSASPVNEIVTQLFGVTPLEPGFARVR
IAPRRELLEAAEGTLHTPRGDLHLRWAQGEALTVEATREMAVEVVLGATTYPTVLAPGET
VCFQ

Enzyme Prediction     

EC	-	-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	309	764	1.3e-93	0.8849206349206349
CBM67	10	205	5.1e-28	0.9545454545454546

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
407469	Bac_rhamnosid6H	2.00e-12	373	700	11	334	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
379972	Bac_rhamnosid_C	0.002	708	746	1	40	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15768.1|GH78	0.0	3	783	5	789
BCS04174.1|GH78	0.0	3	783	5	789
CAK49119.1|GH78	0.0	3	781	5	787
QDS72372.1|CBM67|GH78	1.03e-254	4	770	6	778
BCS25990.1|GH78	4.05e-215	4	765	5	776

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4XHC_A	5.32e-15	332	698	172	534	Chain A, Alpha-L-rhamnosidase [Klebsiella oxytoca],4XHC_B Chain B, Alpha-L-rhamnosidase [Klebsiella oxytoca]
2OKX_A	2.90e-10	51	252	39	223	Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1],2OKX_B Crystal structure of GH78 family rhamnosidase of Bacillus SP. GL1 AT 1.9 A [Bacillus sp. GL1]

Swiss-Prot Hits     

PWY75354.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000058	0.000000

TMHMM  Annotations     

There is no transmembrane helices in PWY75354.1.