CAZyme Information: PWY75035.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75035.1
• CAZy Family: GH12
• CAZyme Description: GDSL lipase/acylhydrolase family protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
353	MSFL01000022|CGC6	39567.07	4.6712

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000022:161457-162644(-)

Full Sequence      

MRHVHPLLLALALQVARAEQRWGPSRFSNLVTFGDSYTDDTRFEYFYTHDGSAPPVGWVE
PVANVSSSGGYVWGEYVSQYANLSHRYNYAVSGAACSNKITPRLATLGSSSAFYPSVLEY
QVPAFTADNNYHLPSGQKFLDIPADETIFALWIGTNDLGVNSFLTDSQVTNTTIPDYIDC
VYSSLDGVYNTGAAKYFVLMNLAPLQLAPLYATSDHHGVGPNDYWPDKPSNITEISYRMW
EQVATANDVYDYRTPYELLVGNRYPGAKFAVMDTFALISEIYNNPSEYLAAPANVTGYDY
VCNINATVCEHLPNLESYLWFDQLHPSVRTHQIIAKEFVNVVRGESRFATYWS

Enzyme Prediction     

No EC number prediction in PWY75035.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE16	30	338	1.1e-73	0.9925093632958801

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
238882	fatty_acyltransferase_like	5.35e-49	29	341	1	270	Fatty acyltransferase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Might catalyze fatty acid transfer between phosphatidylcholine and sterols.
225780	COG3240	1.79e-14	24	335	26	326	Phospholipase/lecithinase/hemolysin [Lipid transport and metabolism, General function prediction only].
238875	SGNH_plant_lipase_like	1.02e-09	148	340	131	313	SGNH_plant_lipase_like, a plant specific subfamily of the SGNH-family of hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases.
238883	Triacylglycerol_lipase_like	8.95e-08	27	341	1	280	Triacylglycerol lipase-like subfamily of the SGNH hydrolases, a diverse family of lipases and esterases. The tertiary fold of the enzyme is substantially different from that of the alpha/beta hydrolase family and unique among all known hydrolases; its active site closely resembles the Ser-His-Asp(Glu) triad found in other serine hydrolases. Members of this subfamily might hydrolyze triacylglycerol into diacylglycerol and fatty acid anions.
395531	Lipase_GDSL	1.49e-06	30	338	1	224	GDSL-like Lipase/Acylhydrolase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCS15697.1|CE16	2.92e-172	2	353	5	355
BCS04097.1|CE16	2.92e-172	2	353	5	355
QMW44554.1|CE16	7.62e-146	3	352	2	353
QRD84022.1|CE16	7.62e-146	3	352	2	353
BAE62044.1|CE16	7.62e-146	3	352	2	353

PDB Hits     

PWY75035.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A7J2C6|AES1_HYPJE	2.50e-87	27	352	27	345	Acetylesterase OS=Hypocrea jecorina OX=51453 GN=aes1 PE=1 SV=1
sp|Q9FJ40|GDL86_ARATH	1.13e-08	136	331	166	357	GDSL esterase/lipase At5g45960 OS=Arabidopsis thaliana OX=3702 GN=At5g45960 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000197	0.999782	CS pos: 18-19. Pr: 0.9801

TMHMM  Annotations     

There is no transmembrane helices in PWY75035.1.