CAZyme Information: PWY75030.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75030.1
• CAZy Family: GH12
• CAZyme Description: pectinesterase pmeA

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
330		35234.41	3.8869

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000022:150053-151433(-)

Full Sequence      

MVKSILSSALFAATALAASRTTAPSGSITVAKSGGDYDTISSAVAALSTTTTDTQTIFIE
AGEYEEQVLVPALAGKLIIYGETEDDTSYADNTVNVTYGLGLADVSSDDETATFRIHTSN
AAIYNINFINSGGASAKQALAVSAYETEQGFYGVGMYGYQDTLLAETGNQVYLNSYIEGA
IDFIFGQHARAWFQNCDIRVVEGPSSASITANGRSSETDTSFYVIHKSTVAAAAGNDVAS
GTYYLGRPWSEYARVCFQETSMTDVINALGWTEWSTSEPNTEYVTFEEYDNTGAGSEGTR
ASFSSKISTPYTISTILGSDYADWVDTTYL

Enzyme Prediction     

EC	3.1.1.11:8

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	28	307	9.2e-77	0.9375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
395871	Pectinesterase	2.02e-51	28	320	2	298	Pectinesterase.
178346	PLN02745	3.52e-40	23	299	282	554	Putative pectinesterase/pectinesterase inhibitor
215179	PLN02314	1.20e-39	21	328	273	578	pectinesterase
178113	PLN02497	2.31e-39	27	309	33	308	probable pectinesterase
177947	PLN02313	5.06e-38	29	328	278	579	Pectinesterase/pectinesterase inhibitor

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK38387.1|CE8	2.27e-169	1	330	1	330
CAA02202.1|CE8|3.1.1.11	1.86e-168	1	330	1	330
CAA02198.1|CE8|3.1.1.11	1.86e-168	1	330	1	330
AKA88527.1|CE8	1.86e-168	1	330	1	330
CAA37084.1|CE8|3.1.1.11	1.86e-168	1	330	1	330

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5C1E_A	1.43e-62	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.02e-62	19	329	2	299	Crystal Structure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
1GQ8_A	2.79e-34	28	295	10	272	Pectin methylesterase from Carrot [Daucus carota]
1XG2_A	1.88e-24	30	295	7	268	Chain A, Pectinesterase 1 [Solanum lycopersicum]
4PMH_A	1.58e-12	34	295	45	365	The structure of rice weevil pectin methyl esterase [Sitophilus oryzae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P17872|PME_ASPNG	3.30e-169	1	330	1	330	Pectinesterase OS=Aspergillus niger OX=5061 GN=pme1 PE=1 SV=1
sp|Q12535|PME_ASPAC	1.33e-161	1	329	1	330	Pectinesterase OS=Aspergillus aculeatus OX=5053 GN=pme1 PE=2 SV=1
sp|Q2UBD9|PMEA_ASPOR	3.11e-70	20	329	28	324	Probable pectinesterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=pmeA PE=3 SV=1
sp|B8NPS7|PMEA_ASPFN	8.76e-70	20	329	28	324	Probable pectinesterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=pmeA PE=3 SV=1
sp|Q4WBT5|PMEA_ASPFU	9.76e-66	20	329	28	324	Probable pectinesterase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=pmeA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000397	0.999594	CS pos: 17-18. Pr: 0.9735

TMHMM  Annotations     

There is no transmembrane helices in PWY75030.1.