CAZyme Information: PWY75014.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY75014.1
• CAZy Family: GH114
• CAZyme Description: Glucan 1,4-alpha-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A317VKX0]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1206	MSFL01000022|CGC2	131487.86	4.4514

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000022:104509-109173(+)

Full Sequence      

MSLRSLLTVSGLVCSGLASVLSRRATLDSWLTSEATVARTAILNNIGADGVWVAGADSGI
VVASPSTDNPDYFYTWTRDSGLVIKTLVDLFRNGDTGLLSTIEQYISAQAIVQGISNPSG
SLSSGGLGEPKFNVDETAFTGAWGRPQRDGPALRATAMIDFGEWLIENGYTSIATDIIWP
LVRNDLSYVAQYWNQTGYDLWEEIDGSSFFTIAVQHRALVEGNTFAANVGSSCSWCESQA
PQILCYLQSFWTGSYILANFDSSRSGLDANTLLGSIHTFDPEAGCDDSTFQPCSPRALAN
HKEVVDSFRSIYTLNDGYTESEAVAVGRYPEDVYYDGNPWFLCTLAAAEQLYDALYQWNQ
QGSLEITDVSLAFFQALYSSAATGTYSSSSSTYTSIVDAVKTYADGFVTFVETHAATNGS
LSEQYSKTDGLELSARDLTWSYAALLTANNRRNSVVPAAWGETSASSVPATCVSTSATGT
YSSVTIASWPTIVVSGATSATTTATATATGSATTTTASKTTTSSTSCTTPTAVAVTFDLS
ATTTYGENIYLVGSISQLGDWDTSDGIALSASDYTTSDPLWFVTVTLPAGESFEYKFIRI
ETDGTVEWESRKAVRHCGYGGDKALRLRGATAQGVGLPLGTGWDATGTSTPARKPNFLFI
LTDDQDLQMNSPAYMPHTQSRIKDQGVEFLNHFVTTALCCPSRVSLWTGRQAHNTNVTDV
SPPYGGYPKFVSQGFNDNFLPVWLQSAGYNTFYTGKLFNAHSVTTYNAPFVNGFNGSDFL
LDPFTYSYWNATYQRNHEPPRSYEGQYTTDVMKDKALGLLDDALASDSPFFLTVAPIAPH
TNIDMKAATVGAMSSPQMTEPLPAPRHASLFSDAKVPRTPNFNPSVKSGASWVQTLELQN
QTVIDYQDHVYRQRLRALQAVDEMVDALIARLEDSGQLDNTYIIYSADNGYHIGQHRLPP
GKTTGYEEDIRVPFYIRGPGIPQGGSVDRVTTHIDIAPTLFDLARLPLRNDFDGTPMPVP
SQRETETQTQSILHEHVTVEFWGHSVLEGEYSRIGYMGTSNVPNNTYKSARILSQEYNLY
YSVWCSGDHELYDLSTDPYQMTNLYPARASLTLLNRPLELVIDRVDALLLVLKSCKGSTC
VQPWKVLHSDGSVASLKDALGTEYDAFYAAQPKVQYTACEAGYLIESEGPQAGLQYRDGL
SWEAWT

Enzyme Prediction     

EC	3.2.1.3:94	3.2.1.3:71

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH15	43	448	8.8e-79	0.9806094182825484
CBM20	533	611	9.4e-27	0.8333333333333334

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
293766	G6S	0.0	654	1106	1	394	glucosamine (N-acetyl)-6-sulfatase(G6S, GNS) AND sulfatase 1(SULF1). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficient of N-acetylglucosamine-6-sulfatase results in disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease. SULF1 encodes an extracellular heparan sulfate endosulfatase, that removes 6-O-sulfate groups from heparan sulfate chains of heparan sulfate proteoglycans (HSPGs).
395586	Glyco_hydro_15	3.11e-144	37	450	2	417	Glycosyl hydrolases family 15. In higher organisms this family is represented by phosphorylase kinase subunits.
293755	G6S_like	2.44e-71	653	1111	1	418	unchracterized sulfatase homologous to glucosamine (N-acetyl)-6-sulfatase(G6S, GNS). N-acetylglucosamine-6-sulfatase also known as glucosamine (N-acetyl)-6-sulfatase hydrolyzes of the 6-sulfate groups of the N-acetyl-D-glucosamine 6-sulfate units of heparan sulfate and keratan sulfate. Deficiency of N-acetylglucosamine-6-sulfatase results in the disease of Sanfilippo Syndrome type IIId or Mucopolysaccharidosis III (MPS-III), a rare autosomal recessive lysosomal storage disease.
293763	ARS_like	7.28e-49	655	1109	1	411	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
395712	Sulfatase	2.52e-48	655	1004	1	296	Sulfatase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
EAA64118.1|CBM20|GH15	0.0	27	1191	36	1236
AAS91802.1|CBM20|GH15|3.2.1.3	0.0	1	610	1	615
QGP74527.1|CBM20|GH15	0.0	1	610	1	619
BCS12431.1|CBM20|GH15	0.0	1	610	1	615
BCS00667.1|CBM20|GH15	0.0	1	610	1	615

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6FRV_A	0.0	25	610	1	592	Structure of the catalytic domain of Aspergillus niger Glucoamylase [Aspergillus niger]
1GAI_A	3.75e-301	25	496	1	472	GLUCOAMYLASE-471 COMPLEXED WITH D-GLUCO-DIHYDROACARBOSE [Aspergillus awamori]
1GAH_A	2.91e-300	25	495	1	471	GLUCOAMYLASE-471 COMPLEXED WITH ACARBOSE [Aspergillus awamori]
1AGM_A	3.97e-300	25	493	1	469	Refined structure for the complex of acarbose with glucoamylase from Aspergillus awamori var. x100 to 2.4 angstroms resolution [Aspergillus awamori],1DOG_A REFINED STRUCTURE FOR THE COMPLEX OF 1-DEOXYNOJIRIMYCIN WITH GLUCOAMYLASE FROM (ASPERGILLUS AWAMORI) VAR. X100 TO 2.4 ANGSTROMS RESOLUTION [Aspergillus awamori],1GLM_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori],3GLY_A REFINED CRYSTAL STRUCTURES OF GLUCOAMYLASE FROM ASPERGILLUS AWAMORI VAR. X100 [Aspergillus awamori]
3EQA_A	1.13e-299	25	493	1	470	Catalytic domain of glucoamylase from aspergillus niger complexed with tris and glycerol [Aspergillus niger]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P22832|AMYG_ASPUS	0.0	1	610	1	615	Glucoamylase OS=Aspergillus usamii OX=186680 GN=glaA PE=3 SV=1
sp|P69328|AMYG_ASPNG	0.0	1	610	1	616	Glucoamylase OS=Aspergillus niger OX=5061 GN=GLAA PE=1 SV=1
sp|P69327|AMYG_ASPAW	0.0	1	610	1	616	Glucoamylase OS=Aspergillus awamori OX=105351 GN=GLAA PE=1 SV=1
sp|P23176|AMYG_ASPKA	0.0	1	610	1	615	Glucoamylase I OS=Aspergillus kawachii OX=1069201 GN=gaI PE=1 SV=1
sp|P36914|AMYG_ASPOR	1.36e-284	20	610	23	588	Glucoamylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=glaA PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.204509	0.795465	CS pos: 22-23. Pr: 0.6199

TMHMM  Annotations     

There is no transmembrane helices in PWY75014.1.