CAZyme Information: PWY74326.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY74326.1
• CAZy Family: GH1
• CAZyme Description: glycoside hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
326		35954.45	3.7661

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000023:162559-163702(-)

Full Sequence      

MYSITAVILALAVGGHAISPRESNSLGESLGIKPDSMISYDGIYFGWAPNYSPQVTLADL
NEATGQKGATYNVYSQITQDNVDSNSYDGNDQYNVDDIISSGAVLIASLMPTVDWTDITE
ELCNSVADYFKTTFTSKNVTVWLRYAHEMNYYADPSVDTYPGGRDYSAFLTTWKSMHAAT
HPNPLIHMFWSPNENTTSEPVAPWWPGEDYVDIVGMDYYPDASDLPDFATAYGDFYDTYA
KGYSLPFAIAETGTQLGSGAATVAQKQQWLKSIINPAAGLGDYDEFYVSCTWFEYGPPTN
EVDFYIVYGQTEAVVEETISNTESGV

Enzyme Prediction     

No EC number prediction in PWY74326.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH26	84	271	2.1e-19	0.5412541254125413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226609	ManB2	5.78e-09	122	257	167	300	Beta-mannanase [Carbohydrate transport and metabolism].
396639	Glyco_hydro_26	0.005	190	258	203	262	Glycosyl hydrolase family 26.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CCD43969.1|GH26	1.39e-59	34	325	36	316
ATZ47880.1|GH26	1.64e-58	34	325	83	363
QSZ35056.1|GH26	1.71e-54	9	311	9	301
APA07880.1|GH26	2.51e-51	3	325	11	317
UKZ74809.1|GH26	2.93e-51	34	318	32	307

PDB Hits     

PWY74326.1 has no PDB hit.

Swiss-Prot Hits     

PWY74326.1 has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000213	0.999758	CS pos: 17-18. Pr: 0.9841

TMHMM  Annotations     

There is no transmembrane helices in PWY74326.1.