CAZyme Information: PWY74223.1

Basic Information

• Species: Aspergillus eucalypticola
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus eucalypticola
• CAZyme ID: PWY74223.1
• CAZy Family: GH33
• CAZyme Description: alcohol oxidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MSFU01000011|CGC7	70246.21	4.9230

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AeucalypticolaCBS122712	12207	1448314	274	11933

• Gene Location: location=MSFU01000011:909661-911930(-)

Full Sequence      

MWSHLQSAVLFSICLSPAVATPYIYHRRPVFQEYLGTETDLNPPKPSDAYDYVVVGGGVT
GLIAAGRLAEHYNVAVVERGGYYEKMTGNLSQVPGYTELFDNSNTPPRDDVEYWWEVPGT
PETNNRALNFTGGKMMGGSHAFSYFGYLRPTYGAMQKWADEVGDQSWTYPNTEEYFDKSI
KFTPPNSTTRLANATPEYDPSLKGTGPLEITYPRWVHPFSTWLAKAFDALGVKHTLSYAN
GELFGSSWILDTINSTDGTRSTSWTAYVKNAPPSKKKLDIFSFTLAEKIQFDGTKATGVA
VTREISPPSGGPPSIEQFTIETNNEVVLAGGGVLSPQLLMVSGVGPEKQLQELNITPVLK
NDAVGQNMHDHIVFPVAYRVKTPTSSVLLDDEKRWHEEDLFKENVTGMLTNPGPDFGGIV
DIPSDLRNFSLSTKAELAGLPKDWPELIIVSFPLGHDYPDDGYNYASLMGVPMTSMSVGN
ITLNSTKMSDKPIVRPHWLTSTTDLEVSIASLKYMRRVFENPAMEPIIIGDEFAPGPEAA
TWAEVEHALKNSFRSMHHPAATLRMGREDDPNAVVDSRGSIMGLDNVRVVDPSAFPFLPP
GLPLAPAFMFAEKITDNIINDQKSGKKKGHDELRTDL

Enzyme Prediction     

No EC number prediction in PWY74223.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA3	49	620	1.4e-151	0.9947183098591549

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
225186	BetA	4.64e-59	63	623	21	538	Choline dehydrogenase or related flavoprotein [Lipid transport and metabolism, General function prediction only].
235000	PRK02106	1.28e-52	121	618	73	531	choline dehydrogenase; Validated
398739	GMC_oxred_C	4.29e-31	477	614	3	143	GMC oxidoreductase. This domain found associated with pfam00732.
366272	GMC_oxred_N	1.77e-18	119	373	10	218	GMC oxidoreductase. This family of proteins bind FAD as a cofactor.
215420	PLN02785	4.00e-10	49	389	55	345	Protein HOTHEAD

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43129.1|AA3_2	0.0	1	637	1	637
BCR98269.1|AA3_2	5.27e-225	1	325	1	325
BCS10611.1|AA3_2	5.27e-225	1	325	1	325
BCS10610.1|AA3_2	4.19e-210	340	637	1	298
CAP40103.1|AA3_2	5.94e-162	1	637	1	664

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5OC1_A	8.57e-45	50	622	2	565	Crystal structure of aryl-alcohol oxidase from Pleurotus eryngii in complex with p-anisic acid [Pleurotus eryngii]
3FIM_B	4.15e-44	50	622	3	566	Crystal structure of aryl-alcohol-oxidase from Pleurotus eryingii [Pleurotus eryngii]
6ZE2_A	2.17e-39	50	623	6	587	Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE3_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE4_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE5_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE6_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],6ZE7_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_A Chain A, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495],7AA2_B Chain B, FAD-dependent oxidoreductase [Thermochaetoides thermophila DSM 1495]
2JBV_A	4.29e-34	50	626	14	533	Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],2JBV_B Crystal structure of choline oxidase reveals insights into the catalytic mechanism [Arthrobacter globiformis],4MJW_A Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis],4MJW_B Crystal Structure of Choline Oxidase in Complex with the Reaction Product Glycine Betaine [Arthrobacter globiformis]
3NNE_A	5.79e-34	50	626	14	533	Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_B Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_C Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_D Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_E Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_F Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_G Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis],3NNE_H Crystal structure of choline oxidase S101A mutant [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|A0A2V5GRB0|PYVF_ASPV1	2.38e-180	25	637	23	629	Dehydrogenase pyvF OS=Aspergillus violaceofuscus (strain CBS 115571) OX=1450538 GN=pyvF PE=3 SV=1
sp|A1CFL2|PATE_ASPCL	8.70e-127	47	618	48	624	Patulin synthase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=patE PE=1 SV=1
sp|A0A075TRK9|PATE_PENEN	1.91e-125	26	618	31	624	Patulin synthase OS=Penicillium expansum OX=27334 GN=patE PE=1 SV=1
sp|A0A1U8QYA8|CICC_EMENI	1.10e-115	44	621	30	610	Oxidoreductase cicC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicC PE=1 SV=1
sp|Q5B8A1|PKFF_EMENI	8.77e-107	50	618	41	607	Dehydrogenase pkfF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=pkfF PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.288865	0.711117	CS pos: 20-21. Pr: 0.6763

TMHMM  Annotations     

There is no transmembrane helices in PWY74223.1.