CAZyme Information: PWY73635.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY73635.1
• CAZy Family: CE4
• CAZyme Description: glycosyl hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
478	MSFL01000024|CGC1	52397.67	4.6892

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000024:254784-256456(+)

Full Sequence      

MRGLLHSLGALFLLLCHSQLAHSALDIQVNDADSLTNAGVAIAEPMMTFYKQNQTEGIPG
KLTDTWYIAGSMFMTLIQFWQASGVDTYNSVVQHDLMFQAGENSDFFSANYSQWLGNDDQ
MFWGLAAITASEAGFPEVSNKPSWTSLARAVFNMQINRWDDTACHGGMRWQVWPYQAGYT
MKNAISNGGLFELSARLARFTKNETYAQWAEKIWDWSATTPLLDTNVSAGLTWNIADSTS
NEAGCQDAGNNQWSYNYGTYLAGAAFMYNYTNGSPTWLNRVNSLLDSTFTRFFPTSFADG
TILSEVACEPILSCDRNQLCFKGYVAMWLAFTSILVPSTSDRIVPKLQGSAEAIGRQCTG
SANGLDNLCGVRWHQDGWDGSLGLEVQMSALGGVTSNLMLLGRGSPQTIVENPGGAEHHI
DTSGDERDPSKQRPITAGDRAGAWILTVGVAGGCWGLWGGWLRRSRFGFNVVDGIFGF

Enzyme Prediction     

No EC number prediction in PWY73635.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	31	401	1.9e-94	0.9385474860335196

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
397638	Glyco_hydro_76	5.29e-179	34	391	1	348	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR96455.1|GH76	2.84e-268	6	466	4	462
BCS08967.1|GH76	2.84e-268	6	466	4	462
CAK37547.1|GH76	8.35e-267	6	469	4	465
BAE66452.1|GH76	7.39e-242	1	466	1	458
QMW48345.1|GH76	1.05e-241	1	466	1	458

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6RY0_A	3.11e-81	18	440	19	443	Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY1_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY2_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY5_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY6_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495],6RY7_A Chain A, Mannan endo-1,6-alpha-mannosidase [Thermochaetoides thermophila DSM 1495]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|O74556|YCZ2_SCHPO	1.29e-89	24	400	19	386	Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC970.02 PE=3 SV=1
sp|P36091|DCW1_YEAST	2.23e-89	23	458	20	446	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DCW1 PE=1 SV=1
sp|Q6FLP9|DCW1_CANGA	9.84e-87	25	448	19	431	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) OX=284593 GN=DCW1 PE=3 SV=1
sp|Q9P6I3|YHG7_SCHPO	2.71e-85	29	447	24	426	Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC1198.07c PE=3 SV=2
sp|Q75DG6|DCW1_ASHGO	1.83e-81	25	448	22	436	Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) OX=284811 GN=DCW1 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000211	0.999744	CS pos: 23-24. Pr: 0.9702

TMHMM  Annotations     

Start	End
440	462