CAZyme Information: PWY73058.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY73058.1
• CAZy Family: PL1
• CAZyme Description: glycosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
410	MSFL01000025|CGC6	46639.15	7.6079

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000025:521526-522929(+)

Full Sequence      

MIWRGLCRRPLLLAIAMVVCFTWLFYRSDTLGDEVSLLERHHPLLFRYVHTNSALGGAWY
IPRDWLSDTDHHPGGIVDAAQLALRAARSSVERQIPHSSIPLIVHQTWKNTRIDTWPRPI
RHSTERWLRMIDGKAAYILWDDDGVAQFIQRFESELEEQFFALSPVERADVFRVLVSKWI
GGVYADMDTEPLRSPADWISHSDLLPWQDPEAGKMYNSPGPVNAILGVEADCPSNSDDYW
RMGYLHPLQLTQWAFAWAPGHPILQTFVDRLTAQLRTIMDQNGGLQTMSARQALRSLDPI
ALTGPGAITQATQSWLETTADLRWTALSGLHDNGTSKLVDDVLILPITGFSPGRRGYGNM
GSKPISDPSARLLHRAQGSWRAFDLRVEYGKFCRTMFGRCRHWSKVPHHR

Enzyme Prediction     

No EC number prediction in PWY73058.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
226297	OCH1	6.46e-17	14	276	8	248	Mannosyltransferase OCH1 or related enzyme [Cell wall/membrane/envelope biogenesis].
398274	Gly_transf_sug	4.94e-07	137	205	20	93	Glycosyltransferase sugar-binding region containing DXD motif. The DXD motif is a short conserved motif found in many families of glycosyltransferases, which add a range of different sugars to other sugars, phosphates and proteins. DXD-containing glycosyltransferases all use nucleoside diphosphate sugars as donors and require divalent cations, usually manganese. The DXD motif is expected to play a carbohydrate binding role in sugar-nucleoside diphosphate and manganese dependent glycosyltransferases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCR93027.1|GT32	2.46e-183	12	407	14	408
BCS05686.1|GT32	2.46e-183	12	407	14	408
CAK38082.1|GT32	9.97e-183	38	407	37	408
ADK37855.1|GT32	6.45e-172	8	385	7	385
QMW48355.1|GT32	3.60e-164	3	408	6	412

PDB Hits     

PWY73058.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q9UTR6|OCH1_SCHPO	1.79e-28	88	381	129	394	Initiation-specific alpha-1,6-mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=och1 PE=1 SV=2
sp|Q5A4E3|OCH1_CANAL	5.21e-20	88	381	84	376	Initiation-specific alpha-1,6-mannosyltransferase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=OCH1 PE=3 SV=1
sp|P31755|OCH1_YEAST	9.38e-14	84	381	77	470	Initiation-specific alpha-1,6-mannosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCH1 PE=1 SV=1
sp|P47124|HOC1_YEAST	2.20e-13	97	351	127	362	Putative glycosyltransferase HOC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HOC1 PE=1 SV=3

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
0.999757	0.000268

TMHMM  Annotations     

Start	End
5	27