CAZyme Information: PWY73017.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY73017.1
• CAZy Family: GT8
• CAZyme Description: unspecified product

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
495		52514.19	3.7826

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000025:422250-423791(+)

Full Sequence      

MGSLPTLLLAVASCFIPAEAVHFSSHGYLHAARHHHQSRTVDPSVSFPGLSMFPNGSLSG
LDLSSACEDALSQKIYCDETVSSLITDDYIGSFDNSTLTALVCASSCGSSIAELHESVSA
SCGTTADLIPGISFLALVDELWSNWNQSCITDPTTGENCNDEIASFDNVTALADMATSDL
CSYCYVKKLEMMQEDAFSDAYNDDFQFTYEYVAASCNLTVADFNATASAFNASVPTSTSS
CVSGDMYTTVEGDTCDSIALAKGVSAATMYYTNPNIVNCSDILAGTTLCLPLSCTDLYSV
KANDTCTSIAVDYYLSTQEVINWNSQLNWNCSNLHSTNPYWGSVLCVSPPGGTYTGHALN
TTASDSTEPEAAYPPAGVKVAPGTTLDCGGWFVNSASLNYTCSEICLYNDIPIHLFTAAN
PSLNYTTCNSDLVAGYAYCIDPLTGWQYSNATATNSTAIITAATSPTEPTQTGIPANCDA
YYVAQCTCKLPITFI

Enzyme Prediction     

No EC number prediction in PWY73017.1.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
197609	LysM	4.07e-06	298	347	2	44	Lysin motif.
212030	LysM	1.28e-05	298	334	3	39	Lysin Motif is a small domain involved in binding peptidoglycan. LysM, a small globular domain with approximately 40 amino acids, is a widespread protein module involved in binding peptidoglycan in bacteria and chitin in eukaryotes. The domain was originally identified in enzymes that degrade bacterial cell walls, but proteins involved in many other biological functions also contain this domain. It has been reported that the LysM domain functions as a signal for specific plant-bacteria recognition in bacterial pathogenesis. Many of these enzymes are modular and are composed of catalytic units linked to one or several repeats of LysM domains. LysM domains are found in bacteria and eukaryotes.
396179	LysM	3.68e-05	298	347	1	42	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.
197609	LysM	7.53e-05	247	290	2	44	Lysin motif.
396179	LysM	1.61e-04	247	291	1	43	LysM domain. The LysM (lysin motif) domain is about 40 residues long. It is found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function. The structure of this domain is known.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APA07678.1|CBM50	2.90e-192	22	483	17	482
CEF83616.1|CBM50	1.69e-137	38	456	19	429
CZS74850.1|CBM50	1.92e-136	38	466	19	440
QKD59081.1|CBM50	5.94e-113	45	482	22	447
QKD61253.1|CBM50	5.94e-113	45	482	22	447

PDB Hits     

PWY73017.1 has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|D4AVW3|LYSM5_ARTBC	1.06e-08	37	494	31	504	LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_00327 PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000227	0.999756	CS pos: 20-21. Pr: 0.9768

TMHMM  Annotations     

There is no transmembrane helices in PWY73017.1.