CAZyme Information: PWY72425.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY72425.1
• CAZy Family: AA9
• CAZyme Description: Beta-glucosidase [Source:UniProtKB/TrEMBL;Acc:A0A317VEV7]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860		92819.77	4.2098

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000026:524043-526968(+)

Full Sequence      

MRFGWIEAAALTAASVVSADELAYSPPFYPSPWANGQGDWASAYERAVAIVSQMTLAEKV
NLTTGTGWELEKCVGQTGGVPRLGIPGMCGQDSPLGVRDSDYNSAFPAGINIGATWDKNL
AYLRGQAMGQEFSDKGADFQLGPVAGPLGRAPDGGRNWEGFSPDPALTGVLFAETIKGIQ
DAGVVATAKHFIGYEQEHFREAPEAQGYGYNITESGSANIDDKTMHELYLWPFADAVRAG
VGAIMCSYNQINNSYACQNSYALNKLLKGELGFQGFVMSDWEAHHSGASAAMAGLDMSMP
GDVVFDSGTSYWGTNLTIGVLNGTVPQWRVDDMAVRIMAAYYKVGRDRLWTPPNFSSWTR
DEYGFKYYYSSEGPYEVVNHFVDVRRNHSDLIRRIGADSTVLLKNDGCALPLTGTERKVA
LIGEDAGSNPYGADGCSDRGCDNGTLAMGWGSGTTEYPYLVTPEQAIQAEVIQNGGTVFA
VTDNWAISQMETLAAEATVSLVFVNADSGEGYIDVDGNMGDRNNLTLWGNGDNVIKAAAS
NCNNTIVIIHSVGPVLVNEWYDHPNVTAILWAGLPGQESGNSLADVLYGRVNPGAKSPFT
WGKTRESYQDYLITEPNNGDGAPQEDFTEGVFIDYRGFDKRNETPIYEFGYGLSYTTFNY
SQLQVQALNASAYTPASGETEAAPTLGEAGNASDYLYPSGLQRITAFIYPWLNSTDLEAS
SGDSSYGQSSDFLPEGATDGSAQPILPAGGGPGGNPALYDDLIQVSVTIKNTGDIAGDEI
PQLYVSLGGPDEPRIVLRKFDRITLQPSEEYEWTTTLTRRDLSNWDVAAQDWIVTSYPKK
VYVGSSSRKLPLRASLPTVQ

Enzyme Prediction     

EC	3.2.1.21:43	3.2.1.-:1

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	79	300	2.3e-63	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
396478	Glyco_hydro_3_C	3.92e-61	400	635	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
224389	BglX	6.32e-59	81	447	56	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
185053	PRK15098	1.79e-44	15	826	6	734	beta-glucosidase BglX.
395747	Glyco_hydro_3	1.03e-40	82	337	63	313	Glycosyl hydrolase family 3 N terminal domain.
178629	PLN03080	8.34e-37	8	664	16	642	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBA02054.1|GH3	0.0	1	859	1	859
ABN73102.1|GH3	0.0	1	859	1	859
CAK48740.1|GH3|3.2.1.21	0.0	1	859	1	859
AIE48478.1|GH3	0.0	1	859	1	859
BCS10371.1|GH3	0.0	1	859	1	859

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5JU6_A	0.0	1	856	1	851	Chain A, Beta-glucosidase [Rasamsonia emersonii],5JU6_B Chain B, Beta-glucosidase [Rasamsonia emersonii],5JU6_C Chain C, Beta-glucosidase [Rasamsonia emersonii],5JU6_D Chain D, Beta-glucosidase [Rasamsonia emersonii]
5FJJ_A	0.0	20	860	2	842	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_C Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae],5FJJ_D Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus oryzae]
5FJI_A	0.0	21	859	2	843	Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus],5FJI_B Three-dimensional structures of two heavily N-glycosylated Aspergillus sp. Family GH3 beta-D-glucosidases [Aspergillus fumigatus]
4IIB_A	0.0	20	860	1	841	Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIB_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus [Aspergillus aculeatus],4IIC_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IIC_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with isofagomine [Aspergillus aculeatus],4IID_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IID_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with 1-deoxynojirimycin [Aspergillus aculeatus],4IIE_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIE_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with calystegine B(2) [Aspergillus aculeatus],4IIF_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIF_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with castanospermine [Aspergillus aculeatus],4IIG_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIG_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with D-glucose [Aspergillus aculeatus],4IIH_A Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus],4IIH_B Crystal structure of beta-glucosidase 1 from Aspergillus aculeatus in complex with thiocellobiose [Aspergillus aculeatus]
5NBS_A	0.0	22	857	17	857	Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A],5NBS_B Structural studies of a Glycoside Hydrolase Family 3 beta-glucosidase from the Model Fungus Neurospora crassa [Neurospora crassa OR74A]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|P48825|BGL1_ASPAC	0.0	1	860	1	860	Beta-glucosidase 1 OS=Aspergillus aculeatus OX=5053 PE=1 SV=1
sp|B8NRX2|BGLA_ASPFN	0.0	1	860	1	861	Probable beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=bglA PE=3 SV=1
sp|D0VKF5|BGLA_ASPTE	0.0	1	860	1	861	Probable beta-glucosidase A OS=Aspergillus terreus OX=33178 GN=bglA PE=2 SV=1
sp|D4AN50|BGLA_ARTBC	0.0	1	787	1	812	Probable beta-glucosidase ARB_05654 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) OX=663331 GN=ARB_05654 PE=1 SV=1
sp|A1CR85|BGLA_ASPCL	0.0	1	860	1	867	Probable beta-glucosidase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=bglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	CS Position
0.000371	0.999599	CS pos: 19-20. Pr: 0.9652

TMHMM  Annotations     

There is no transmembrane helices in PWY72425.1.