CAZyme Information: PWY72406.1

Basic Information

• Species: Aspergillus heteromorphus
• Lineage: Ascomycota; Eurotiomycetes; ; Aspergillaceae; Aspergillus; Aspergillus heteromorphus
• CAZyme ID: PWY72406.1
• CAZy Family: AA9
• CAZyme Description: CAP10 domain-containing protein [Source:UniProtKB/TrEMBL;Acc:A0A317VDP2]

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
615	MSFL01000026|CGC2	71413.21	6.2128

Genome Property

Genome Version/Assembly ID	Genes	Strain NCBI Taxon ID	Non Protein Coding Genes	Protein Coding Genes
FungiDB-61_AheteromorphusCBS117.55	11436	1448321	306	11130

• Gene Location: location=MSFL01000026:462156-464062(-)

Full Sequence      

MRTQRFVVWLATFVLISLLLILFKSSNNPSTLTFSPVSDPLPSPIFQRPDIPPDAQLIEQ
STHRKVAQPDDVQLNRIDIEHPIASLVKDAKQQHDQVLLRQSKALTQAVTEYRNRYNMHP
PPHFDKWFQFAKSRGVRLIDEYDSIYHSLLPFWALEPKTIRERARETLGFDNSMIGVLIR
NGTVSLAEGGAYEQYWQRSATVKMIKSFSEHLPDMDLVFNALDEPRVIVPSEDLQRLVAV
AKDRVIPKTFANASPRNAWSGRPADLNKGDRIDEVRTTRFNRFNPQSTWSYSRSSCPVDS
PVRSLDEQAADNVDSYARGELGFVYNTTAFSDICNSPSLRYTYGFFDRPNTFEVVHDLFP
VFSQSKISSYQDILYPSPWYWDNQVPYEEEKDLEWDAKIDKMYWRGSTTGGYSRAGGWRR
QHRQIFLRNVNALNTAKVLSKSDNNQWKPRGVGRNAFADLFDVRFTYIGQCDEEDCAAQR
EYFDVAEPADQQDAWAYKHLLDIDGNAFSGRFYAFLHSKSLIYKISIFREWHDEWLKPWA
HYIPLSLTGDDYLEAMRYFVSEDEGKATAPRLAQQGREWAQKALRNEDMEVWFFRLLLEY
GRLVDDNRENLGFAI

Enzyme Prediction     

No EC number prediction in PWY72406.1.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT90	337	604	1.1e-83	0.98

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
214773	CAP10	1.91e-22	356	603	28	252	Putative lipopolysaccharide-modifying enzyme.
310354	Glyco_transf_90	2.43e-11	360	603	108	322	Glycosyl transferase family 90. This family of glycosyl transferases are specifically (mannosyl) glucuronoxylomannan/galactoxylomannan -beta 1,2-xylosyltransferases, EC:2.4.2.-.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAK43248.1|GT90	0.0	1	615	1	609
BCS10289.1|GT90	0.0	1	615	1	609
BCR97835.1|GT90	0.0	1	615	1	609
UCK57446.1|GT90	4.15e-307	1	615	11	619
BAE54850.1|GT90	2.35e-306	1	615	1	609

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5L0R_A	5.77e-10	337	607	95	345	human POGLUT1 in complex with Notch1 EGF12 and UDP [Homo sapiens],5L0S_A human POGLUT1 in complex with Factor VII EGF1 and UDP [Homo sapiens],5L0T_A human POGLUT1 in complex with EGF(+) and UDP [Homo sapiens],5L0U_A human POGLUT1 in complex with EGF(+) and UDP-phosphono-glucose [Homo sapiens],5L0V_A human POGLUT1 in complex with 2F-glucose modified EGF(+) and UDP [Homo sapiens],5UB5_A human POGLUT1 in complex with human Notch1 EGF12 S458T mutant and UDP [Homo sapiens]
5F84_A	9.38e-10	360	604	154	379	Crystal structure of Drosophila Poglut1 (Rumi) complexed with its glycoprotein product (glucosylated EGF repeat) and UDP [Drosophila melanogaster],5F85_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) and UDP [Drosophila melanogaster],5F86_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with its substrate protein (EGF repeat) [Drosophila melanogaster],5F87_A Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_B Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_C Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_D Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_E Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster],5F87_F Crystal structure of Drosophila Poglut1 (Rumi) complexed with UDP [Drosophila melanogaster]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
sp|Q5K8R6|CXT1_CRYNJ	5.62e-55	79	610	150	662	Beta-1,2-xylosyltransferase 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=CXT1 PE=1 SV=1
sp|Q16QY8|RUMI_AEDAE	9.11e-11	360	604	163	388	O-glucosyltransferase rumi homolog OS=Aedes aegypti OX=7159 GN=AAEL011121 PE=3 SV=1
sp|B0X1Q4|RUMI_CULQU	9.15e-11	360	604	164	389	O-glucosyltransferase rumi homolog OS=Culex quinquefasciatus OX=7176 GN=CPIJ013394 PE=3 SV=1
sp|Q8NBL1|PGLT1_HUMAN	3.50e-09	337	607	123	373	Protein O-glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=POGLUT1 PE=1 SV=1
sp|A0NDG6|RUMI_ANOGA	4.77e-09	360	604	163	386	O-glucosyltransferase rumi homolog OS=Anopheles gambiae OX=7165 GN=AGAP004267 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	CS Position
1.000014	0.000029

TMHMM  Annotations     

Start	End
5	23